RetrogeneDB ID:
retro_opri_191
Organism:
Location:
GeneScaffold_3447:142707-143127 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
60.93 %
Coverage:
96.75 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS27A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S27a [Source:HGNC Symbol;Acc:10417]

Genomic region (view in browser)





>retro_opri_191
CTTACAGGGAAGACTACCACACTTGAGGTTGACCTGTTGGATACAACAAAAAATGTAAGA
CCCAATATCCAGGAAAAGGAACGTATTCTTTCTGATCTGCAAAGACTGATCTTCGCTGGC
AAGCCACTGGAGTACGGACAGACTTCATCTGACTACAACATTCAAAAGGAGTGTATTCAT
GTGTTGGGACTTTGTGGTGGTGGTAAGAAAAGCAAGTCTTACACCACTCCTAAGAGGAAT
AAGCACAAGACAAAGATTAAGTCAGGTGTCCTGAAGTACAAGAATGGGAGATTTAGCTGC
TTATGTAGCAGTACCCTTCAGGTGAATGTGGTGTTGGGAGTGTTCACATCAGCCATTCTG
ACAGACATTACCGTGGGTGAATGCTGTTTGACTTACTGCTTCCACAAACCAGAAAGCAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYK
LTGKT.TLEV...DT..NV...IQ.KE.I..D.QRLIFAGK.LE.G.T.SDYNIQKE...H.VL.L.GG.K..K.KSYTTPK.NKHK..K.K..VLKY..
Retrocopy
LTGKTTTLEVDLLDTTKNVRPNIQEKERILSDLQRLIFAGKPLEYGQTSSDYNIQKE-CIH-VLGLCGGGK--KSKSYTTPKRNKHK-TKIKSGVLKY--


Parental protein
VDENGKIS-RLRRECPSDECGAGVFMASHFDRHY-CGKCCLTYCFNKPEDK
...NG..S..L....PS.ECG.G....SH.DRHY..G.CCLTYCF.KPE.K
Retrocopy
--KNGRFS/LLM*QYPSGECGVGSVHISHSDRHY\VGECCLTYCFHKPESK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide