RetrogeneDB ID:
retro_opri_2
Organism:
Location:
scaffold_5896:131371-131803 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.88 %
Coverage:
95.65 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RRAS2
Parental gene aliases:
No gene alias available
Parental gene description:
related RAS viral (r-ras) oncogene homolog 2 [Source:HGNC Symbol;Acc:17271]

Genomic region (view in browser)





>retro_opri_2
CTGGACACGGCCAGGCAAGAGGAGTTCAGCGCCATGCGGGAGCAGTACATGCGCATGGGG
GATGGCTTCCTCATCGTCTTCTCCGTCACAGACAAGGCCAGCTTTGAGCACGTGGACCGC
TTCCACCAGCTCATCCTCCGTGTCAAGGACAGGGAGTCATTCCTGATGATCCTCGTGGCC
AAAAAGGTGGATCTGATGCACTTGAGGAAAATCACCAGGGAGCAGGGCAAGGAGATGGCG
GCCAAACACAATATTCCATACATAGAGACCAGCGCCCAGGACCCCCCTCTCAATGTGAAC
AAAGCCTTCCATGACCTCGTTAGAGTAATCAGGCAACAGATTCCGGAAAAAAGCCAGAAG
GAGAAGAAGAAAACTAAATGGCGGGGAGACCGGGCCACTGGCACCCACAAACTGCAGTGC
GTGATTTTGTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAK-IRMNVD
LDTA.QEEF.AMREQYMR.G.GFL.VFSVTD..SFE....F...ILRVKDR..F.MIL...K.DL.H.R..T.E.G...A......Y.E.SA.....NV.
Retrocopy
LDTARQEEFSAMREQYMRMGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFLMILVAKKVDLMHLRKITREQGKEMAAKHNIPYIETSAQDPPLNVN


Parental protein
QAFHELVRVIRKFQEQECPPSPEPTRKEKDKKG
.AFH.LVRVIR....Q..P.......K.....G
Retrocopy
KAFHDLVRVIR----QQIPEKSQKEKKKTKWRG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide