RetrogeneDB ID:
retro_opri_246
Organism:
Location:
GeneScaffold_418:524771-525185 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
86.23 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PTP4A1
Parental gene aliases:
No gene alias available
Parental gene description:
protein tyrosine phosphatase type IVA, member 1 [Source:HGNC Symbol;Acc:9634]

Genomic region (view in browser)





>retro_opri_246
GAGCTTAAGAAATACAGAGTGACCACAATAGTAAGAGTGTGCCAAGCGACTTACGACACT
GCTCTTGTGGAGAAGGAGGGCATCCAGGTTGTGGACTGGCCTTTTGACGATGGCTCGTCA
CCTTCCAAACAGATTGTTGATGATTGGGTAAGACTTGTAAGCGTTAAATTCCGTGAAGAA
CCTGGTTGTTGTATCGCCGTTCACTGTGTTGCAGGTCTTGGCAGAACCCCAGTGCTGATT
GCCCTAGCGTTAATCGAAAGTGGAATGAAAAATGAAGATGCAGTGCAGTTGATTCGACAA
AAGCGACGTGGAGCTTTTAACAGTAAGCAACTTTTGTATTTGGAGAAATACCATTCTAAA
ATGCGGCTGCGCTTTAAAGACTCCAATGGCCACAGAAACAACTGTTGCATTCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQ
ELKKY.VTTIVRVC.ATYDT.LVEKEGI.V.DWPFDDG..PS.QIVDDW..LV..KFREEPGCCIAVHCVAGLGR.PVL.ALALIE.GMK.EDAVQ.IRQ
Retrocopy
ELKKYRVTTIVRVCQATYDTALVEKEGIQVVDWPFDDGSSPSKQIVDDWVRLVSVKFREEPGCCIAVHCVAGLGRTPVLIALALIESGMKNEDAVQLIRQ


Parental protein
KRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
KRRGAFNSKQLLYLEKY..KMRLRFKDSNGHRNNCCIQ
Retrocopy
KRRGAFNSKQLLYLEKYHSKMRLRFKDSNGHRNNCCIQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide