RetrogeneDB ID:
retro_opri_250
Organism:
Location:
GeneScaffold_4227:450475-450637 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.73 %
Coverage:
57.89 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
LSM2
Parental gene aliases:
No gene alias available
Parental gene description:
LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:13940]

Genomic region (view in browser)





>retro_opri_250
ATGTTATTCTACTCCGTTTTCCAGGCCCTTGTGAGCAAGGATGTGGTCGTGGAACTCAGG
AATGATTTGATAATTTGTGGGACCCTGCATTCTGTGGATCAGTATCTCAACATCAAACTA
ACCGACACCAGGTCACAGGCCCTGAGATACCCCCACCTGCTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHML
MLFYS.F..LV.KDVVVEL.NDL.ICGTLHSVDQYLNIKLTD........YPH.L
Retrocopy
MLFYSVFQALVSKDVVVELRNDLIICGTLHSVDQYLNIKLTD-TRSQALRYPHLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide