RetrogeneDB ID:
retro_opri_262
Organism:
Location:
GeneScaffold_4352:274883-275213 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
100.0 %
Coverage:
61.8 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PDAP1
Parental gene aliases:
No gene alias available
Parental gene description:
PDGFA associated protein 1 [Source:HGNC Symbol;Acc:14634]

Genomic region (view in browser)





>retro_opri_262
CAAAAGCGCAAAGGCGTGGAAGGGCTCATCGACATTGAGAACCCCAACCGAGTGGCACAG
ACAACCAAAAAGGTCACACAACTGGATCTGGATGGGCCAAAAGAACTTTCCAGGAGAGAA
CGAGAAGAAATTGAAAAGCAGAAAGCAAAAGAGCGTTACATGAAAATGCATTTGGCTGGG
AAGACAGAGCAAGCCAAGGCTGACCTTGCCCGACTGGCAATTATCCGGAAGCAGCGGGAA
GAGGCAGCAAGAAAGAAAGAGGAAGAGAGGAAAGCAAAAGATGACGCGACCTTGTCAGGA
AAACGAATGCAGTCGCTGTCCCTGAACAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSG
QKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSG
Retrocopy
QKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSG


Parental protein
KRMQSLSLNK
KRMQSLSLNK
Retrocopy
KRMQSLSLNK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide