RetrogeneDB ID:
retro_opri_271
Organism:
Location:
GeneScaffold_4429:19333-20059 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.13 %
Coverage:
74.31 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SEPHS1
Parental gene aliases:
No gene alias available
Parental gene description:
selenophosphate synthetase 1 [Source:HGNC Symbol;Acc:19685]

Genomic region (view in browser)





>retro_opri_271
GAGCGAGAGAAGGTGACGCCCCTCATGATCAAGGGCTTTCGAGATGCCGCGGAGGAAGGA
GGGACCGCAGTGACCGGTGGACAGACCGTGGTCAACCCCTGGATTATCATCGGCGGCGTG
GCCACGGTGGTGTGTCAGCCAAACGAGTTCATAATGCCCGACAGCGCGGTCGTTGGAGAT
GTGCTTGTGCTCACCAAACCCCTGGGGACCCAAGTGGCTGTTAATGCCCACCTGTGGCTG
GATAACCCGGAGAGATGGAACAAGATCAAGATGGTGGTCTCCAGGGAGGAGGTGGAGCTG
GCCTATCAGGAGGCGATGTTCAACATGGCTACGCTCAACAGAACTGCTGCCGGCTTAATG
CACACCTTTAATGCCCATGCAGCCACAGACATCACGGGCTTCGGCATCCTGGGACACTCT
CAGAACCTGGCGAAACAACAGCGCAATGAGGTGTCCTTCGTCATTCACAATTTGCCCATC
ATCGCCAAGATGGCCGCCGTCAGCAAGGCCAGCGGGCGCTACGGCCTGCTGCAGGGCACC
TCGGCCGAAACCTCGGGAGGCTTGCTGATTTGTCTGCCCAGGGAACAGGCCGCTCGCTTC
TGCTCTGAGATCAAATCCTCCAAGTACGGCGAGGGTCACCAAGCTTGGATCGTGGGCATT
GTGGAGAAGGGCAACCGGACAGCCCGCATCATTGACAAACCTCGAGTCATTGAGGTCCCA
CCTCGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ERDKVIPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVEL
ER.KV.PL.I.GF.DAAEE.GT.VTGGQTV.NPWI..GGVAT.VCQPNEFIMPD.AV.GDVLVLTKPLGTQVAV..H.WLD.PE.WNKIK.VV..E.VEL
Retrocopy
EREKVTPLMIKGFRDAAEEGGTAVTGGQTVVNPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHLWLDNPERWNKIKMVVSREEVEL


Parental protein
AYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAAR
AYQEAM.NMA.LNRTAAGLMHTFNAHAATDITGFGILGH.QNLAKQQRNEVSFVIHNLP..AKMAAVSKA.G...GL..GT..ETSGGLLICLPREQAAR
Retrocopy
AYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGR-YGLLQGTSAETSGGLLICLPREQAAR


Parental protein
FCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQ
FC.EIKS.KYGEGHQAWI.GIVEKGNRTARIIDKPR.IEV.P.
Retrocopy
FCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKPRVIEVPPR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide