RetrogeneDB ID:
retro_opri_3
Organism:
Location:
scaffold_33177:16902-17259 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.43 %
Coverage:
56.35 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ARF3
Parental gene aliases:
No gene alias available
Parental gene description:
ADP-ribosylation factor 3 [Source:HGNC Symbol;Acc:654]

Genomic region (view in browser)





>retro_opri_3
ATGGGTTTGCTGAATTCTAAGAACCTGAAGGTCAGGCACGCCCAGATTCTGCTTCTGGGA
CTTGACTCTGCCGGGAAGTCCACTCTTCTTTACAAACTAAAGCTTGCTAATGACATCACC
ACCATCCCAACCATAGGTTTTAACGTGGAGATGATCGAATTCGAGAAGAGCTTCTCGTTG
ACAGTGTGGGACGTTGGAGGACAGGAGAAGATGAGAACCACCTGGAGTGACTTCTGCGAG
AACACCGATGGGCTGGTGTACGTGGTGGACAGTTCCGACAAACTGCGCCTGGAGAAGTCC
CGGAGAGAGTTTGAGCGCATTCTGAAGAATGAACACATTAAACATGTGCCTGTTGTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAED
....IL..GLD.AGK.T.LYKLKL....TTIPTIGFNVE..E..K..S.TVWDVGGQ.K.R..W.....NT.GL..VVDS.D..R....R.E..R.L...
Retrocopy
RHAQILLLGLDSAGKSTLLYKLKLANDITTIPTIGFNVEMIEFEKSFSLTVWDVGGQEKMRTTWSDFCENTDGLVYVVDSSDKLRLEKSRREFERILKNE


Parental protein
ELR
...
Retrocopy
HIK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide