RetrogeneDB ID:
retro_opri_394
Organism:
Location:
scaffold_107199:4171-4513 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.91 %
Coverage:
74.03 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PFDN5
Parental gene aliases:
No gene alias available
Parental gene description:
prefoldin subunit 5 [Source:HGNC Symbol;Acc:8869]

Genomic region (view in browser)





>retro_opri_394
CAGGCCAAGTATGTGGCAGCCAAGGAGTGTCTGCACGTGCTAAGCAAGAGTAATGTGGGG
AACGAATCACTCAGCCTGCTGACAAGTTCTAGGTACCTCCCAGGCAAGCTGCGCCATGTG
GAGCATGTGAGAACTGACATGAGAACGGGCTGCTACCTTGGGAAGACAGCTGATGATGCC
AAAGACTTCCTCACAAGGAGGACAGACTTCCTCCCCAAGCAGATGGGGGAAATTCAACCT
GCCCTGCAGGAGAATCATGCCATGAAACAGGCCATCATGATAATGATGAGCTACAAGATC
GTGCTGCTGAAAGCTCTGGGGGAAGCCTATGCCACGGCCAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QTKYVEAKDCLNVLYKSNEGQEILVLVSRSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKI
Q.KYV.AK.CL.VL.KSN.G.E.L.L...S.Y.PGKL..VEHV..D..TG.Y..KTA.DAKDF..R..DFL.KQM..IQPALQE.HAMKQA.M.MMS.KI
Retrocopy
QAKYVAAKECLHVLSKSNVGNESLSLLTSSRYLPGKLRHVEHVRTDMRTGCYLGKTADDAKDFLTRRTDFLPKQMGEIQPALQENHAMKQAIMIMMSYKI


Parental protein
QQLTALGAAQATAK
..L.ALG.A.ATAK
Retrocopy
VLLKALGEAYATAK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide