RetrogeneDB ID:
retro_opri_4
Organism:
Location:
GeneScaffold_4014:134632-135832 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.08 %
Coverage:
83.65 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
DDI2
Parental gene aliases:
No gene alias available
Parental gene description:
DNA-damage inducible 1 homolog 2 (S. cerevisiae) [Source:HGNC Symbol;Acc:24578]

Genomic region (view in browser)





>retro_opri_4
ATGCTGCTCACTGTGTACTGTGTACGGAGGGACCTAACAGAGGTAACCTTCTCCCTCCAG
GTCAGTCCTGACTTTGAGCTCCATGACTTCCGAGTCCTTTGTGAGACAGAGTCCAGAATC
CCTGCTGAGGAGATGCAGATCATTTACATGGAGAGACTCCTGGCTGATGACCACTGCTCC
TTGGGCTCCTATGGCCTCAAAGACGGTGATGTCATCGTACTACTTCAGAAGGAAAATGTG
GGACCCTGGCCTCCAGGACGTACTCTGAATCAGCCTCGAACGGACTTCAATGGAATTGCA
GTGCCTGGGACATCGAACTCTCGGTGGCAGCAGCCACCGCCATGGGTACCTTCTGCTCAT
CAGTCCCATGGCTTGGCCTCTGGAGAGAAGATGGTATCTGCTCAAGATCTGAACAACCCT
GCCTTAGTCCGTAGCATGTTACTGTCCAATCCCCACGATCTGTCTCTGCTGAAGGAACGC
AACCCTTCCTTGGCAGAAGCTCTGCTCAGCGGGAATCTTGAAACATTTTCTCAGGTCTTG
ATGGAGCAGCAGAGGGAAAGGGCCCTGAGAGAGCAAGAGAGGCTTCGCCTCTACACTGCT
GACCCATTTGATAGGGAAGCTCAAGCCAGAATAGAAGAAGAGATCCGGCAGCAGAACATA
GAAGAAAACATGAGTATAGCAATGGAGGAGGCCCCCGAGAGTTTTGGACAAGTGGCCATG
CTCTACATAAACTGCAAAGTGAATGGACATCCTTTGAAGGCTTTTGTTGACTCCGGCGCC
CAGATGACCATTATGAGCCAAGCTTGCGCAGAGAGATGTAACATAATAAGACTAGTAGAT
CGACGGTGGGCTGGAGTGGCAAAAGGAGTGGGCACACAAAGAATTATCGGCCGTGTTCAT
TTAGCTCAGATTCAAATCGAAGGAGACTTCTTGCCATGCTCTTTCTCTATTCTGGAGGAA
CAGCCCATGGATATGCTTCTTGGACTCGACATGCTCAAGAGGCATCAGTGTTCCATTGAT
TTAAAGAAAAATGTGCTGGTGATTGGCACCACTGGCACACAGACGCCCTTTCTTCCTGAG
GGAGAGTTACCCCCTTGCGCTAAGCTGGTAAGTGATACTGGGCAAGAAGAGTCTACAGAC
AAGAAGGCAGCAAACACCTTTAAGCATTCATTCAAGGATTCAGGACGGAAAAAGCATTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCKLESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQKENTDPRPPVQFPNLPRIDFSSIA
MLLTVYCVRRDL.EVTFSLQV..DFELH.FR.LC..ES.IPA.E.QI.Y.ER.L.D.H.SL.SYGLKDGDV..L.QKEN..P.PP....N.PR.DF..IA
Retrocopy
MLLTVYCVRRDLTEVTFSLQVSPDFELHDFRVLCETESRIPAEEMQIIYMERLLADDHCSLGSYGLKDGDVIVLLQKENVGPWPPGRTLNQPRTDFNGIA


Parental protein
VPGTSSSR-QRQPAAVKPSHPS----PGETSASPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLERFSRVLVEQQQDRARREQERIRLFSA
VPGTS.SR.Q..P..V...H.S.....GE...S.Q.L.NPAL.R.MLL.NPH.LSLLKERNP.LAEALLSG.LE.FS.VL.EQQ..RA.REQER.RL..A
Retrocopy
VPGTSNSRWQQPPPWVPSAHQSHGLASGEKMVSAQDLNNPALVRSMLLSNPHDLSLLKERNPSLAEALLSGNLETFSQVLMEQQRERALREQERLRLYTA


Parental protein
DPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVH
DPFD.EAQA.IEE.IRQQNIEENM.IAMEEAPESFGQV.MLYINCKVNGHP.KAFVDSGAQMTIMSQACAERCNI.RLVDRRWAG.AKGVGTQ.IIGRVH
Retrocopy
DPFDREAQARIEEEIRQQNIEENMSIAMEEAPESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIIRLVDRRWAGVAKGVGTQRIIGRVH


Parental protein
LAQVQIEGDFLACSCSI
LAQ.QIEGDFL.CS.SI
Retrocopy
LAQIQIEGDFLPCSFSI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide