RetrogeneDB ID:
retro_opri_417
Organism:
Location:
scaffold_11340:38876-39497 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.57 %
Coverage:
93.21 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
AK4
Parental gene aliases:
No gene alias available
Parental gene description:
adenylate kinase 4 [Source:HGNC Symbol;Acc:363]

Genomic region (view in browser)





>retro_opri_417
GGAAAGGGCACCATGTGCCAGATGATTGCCCAGAACTTTGGCCCGCAACACTTCTCCAGC
GGCCACTTCTTGTGGGAGAACATCAAGGCCAGCACGAAAGTTGGTGATATGGCCAAGCAA
TACCTAGAGAAAGGCCGTTTGGTCCCACATCATGTTATCACACGCCTGATGCTCTCGGAA
CTGGAGAGCAGGAGTGGCCAGCACTGGCTTCTGGACGGTTTTCCAAGGATACTAGTGCAG
GCTGAAGCTCTAGAAAAAATTTGTGACCTGGATCTAGTGATCACTTTGAACATTCTGTTT
GAGACATTGAATGATCGATTCAGCTGTCGTTGGATTCACCCTCCCAGTGGAAGAGTGTAT
AACATGGACTTCAACCCACCTCATGTACATGGAATTGATGACATCACTGGTGAATCATTA
GTCCAACAAGAGAATGCTAAGCCTGAAGCAGTTGCTGCCTGGCTAAGACGGTACAAGGAC
ACTGTAAAGCTAGTCATTGAGCTATACAAGAGCCGAGGAGTGCTGCACCAGTTTTTGGGG
ATGGAGACTAATAAAATCTGGCCTTACGTTTACACGCTTTTCTCAAACAAGATCACACCT
ATTAAATCCAGACAGGCATAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GKGTVCQMIAQNFGLQHLSSGH-LRENIKTNTEVGGMAKKYLERGLLVPDHVITRLMLSELESRSDQHWLLSGFPRTLAQAEALDKICDLDLVITLNIPF
GKGT.CQMIAQNFG.QH.SSGH.L.ENIK..T.VG.MAK.YLE.G.LVP.HVITRLMLSELESRS.QHWLL.GFPR.L.QAEAL.KICDLDLVITLNI.F
Retrocopy
GKGTMCQMIAQNFGPQHFSSGHFLWENIKASTKVGDMAKQYLEKGRLVPHHVITRLMLSELESRSGQHWLLDGFPRILVQAEALEKICDLDLVITLNILF


Parental protein
ETLKDRLSRRWIHPPSGRVYNMDFNPPHVHGIDDITGEALIQQEEDKPEAVAARLRRYKDTAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITP
ETL.DR.S.RWIHPPSGRVYNMDFNPPHVHGIDDITGE.L.QQE..KPEAVAA.LRRYKDT.K.VIELYKSRGVLHQF.G.ETNKIWPYVYTLFSNKITP
Retrocopy
ETLNDRFSCRWIHPPSGRVYNMDFNPPHVHGIDDITGESLVQQENAKPEAVAAWLRRYKDTVKLVIELYKSRGVLHQFLGMETNKIWPYVYTLFSNKITP


Parental protein
VKRRQAF
.K.RQA.
Retrocopy
IKSRQAY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide