RetrogeneDB ID:
retro_opri_470
Organism:
Location:
scaffold_13044:53190-54222 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.23 %
Coverage:
75.39 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
DCAF12
Parental gene aliases:
No gene alias available
Parental gene description:
DDB1 and CUL4 associated factor 12 [Source:HGNC Symbol;Acc:19911]

Genomic region (view in browser)





>retro_opri_470
CTGTTCGTGCTGGACGTGCACTCGGGCCATATCACACACTGCCCCCTGATGGTGGACAGA
GAGCCTCCTCGAGCCGGGAGCCTGCCTGGCTGTGGCATCCACGCCATTGAGCTGAATCCC
TCCAAGACACTTCTGGCCACAGGGGGCAAGAACCCCAATAGCCTGGCCGTGTACCAGCTG
CCCACCATGGACCCTGTGTGCCTGGGTGACATCCAAGGCCACAAAGACTGGATCTTTGCC
ATCGCCTGGGTGAGTGACACCGTGGTGGTGAGCGGTTCCCGTGATGGCACCCTGGCCTTG
TGGCAGTTGGACCGTGAACTTTTCCAGGATGGCAATGTTCGGCCCAGTAGCAGTGGCATC
CCCGTGTATGGCCACATCCGTCCAATGGATATGGTCGATATCTCTACAGGCAGTCCTCTT
CCCAGTCACCACGATGTACGTGCCTTGGCCTTCAGCAGCAGAAACCAGGAGCTGGGATCA
GTTTCTCTGGATGGCTACTTCCACCTCTGGAAAGCTCAGAGCAACCTGTCCAGGCTGCTC
TCCATCAGGATGCCTTACTTTGGAGAAAATGTGTGCATGACCTACTGCGATGAGCTCTCC
CTGTATGCTGTGGGCTCTAGTACCTATGTCTCTTTCCTGGATCCACGCCAGCCACAGGAC
AACTTACGGCCCCTGCACTGCAGGGATCTCGCCACCAGTGTGTATTCACTGAGCTACAAC
CAGGACATCATCACCTTGGGAACAGGGCATGGCTCCCTGCTCTTCTATGACGTCCGTGCC
CACAAGTTCCTAGAGGACAGCCGTGAGTTTTGCCAGGACTCTTCTGCAGGGTCCGGGAGG
AGAATGCTGAAGCTCACCTGTAGCAGGGGCTGGATCAACCAGGAAACCATCTGGGCAGAC
CAGTTTGTAGATTTAGACCAACCACCAAATGCACTATATACCCACTGCTACAACTGGCCA
GATATGAAGCTCTTTGTGGCTGGAGGGCCTCTCTTTTCTGCTCTCCATGGAAACTATGCT
GGCCTGTGGAGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LFVVDVQTSQITKIPILKDREPG-VMTQQGCGIHAIELNPSRTLLATGGDNPNSLAIYRLPTLDPVCVGD-DGHKDWIFSIAWISDTMAVSGSRDGSMGL
LFV.DV....IT..P...DREP.......GCGIHAIELNPS.TLLATGG.NPNSLA.Y.LPT.DPVC.GD..GHKDWIF.IAW.SDT..VSGSRDG...L
Retrocopy
LFVLDVHSGHITHCPLMVDREPPRAGSLPGCGIHAIELNPSKTLLATGGKNPNSLAVYQLPTMDPVCLGDIQGHKDWIFAIAWVSDTVVVSGSRDGTLAL


Parental protein
WEVTDEVLTKSDARHNMSQVPVYSHITHKALKDIPKEDTNPDNCKVRALAFNDKNKELGAVSLC-YFHLW-AENTLSRLLSTKLPYCRENVCLAYGSEWT
W....E.......R...S..PVY.HI......DI......P....VRALAF...N.ELG.VSL..YFHLW.A...LSRLLS...PY..ENVC..Y..E..
Retrocopy
WQLDRELFQDGNVRPSSSGIPVYGHIRPMDMVDISTGSPLPSHHDVRALAFSSRNQELGSVSLDGYFHLWKAQSNLSRLLSIRMPYFGENVCMTYCDELS


Parental protein
VYAEGSQAHVSFLDPRQPSYNVKSVCSRERGSGIRSVSFYEHIITVGTGQGSLLFYDIRAQRFLEERLSACYGSKPRLAGENLKLTTGRGWLNHDETWRN
.YA.GS...VSFLDPRQP..N......R.......S.S....IIT.GTG.GSLLFYD.RA..FLE.....C..S........LKLT..RGW.N....W..
Retrocopy
LYAVGSSTYVSFLDPRQPQDNLRPLHCRDLATSVYSLSYNQDIITLGTGHGSLLFYDVRAHKFLEDSREFCQDSSAGSGRRMLKLTCSRGWINQETIWAD


Parental protein
YFSDIDFFPNAVYTHCYDSSGTKLFVAGGPLPSGLHGNYAGLWS
.F.D.D..PNA.YTHCY.....KLFVAGGPL.S.LHGNYAGLWS
Retrocopy
QFVDLDQPPNALYTHCYNWPDMKLFVAGGPLFSALHGNYAGLWS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide