RetrogeneDB ID:
retro_opri_472
Organism:
Location:
scaffold_131879:274-587 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.76 %
Coverage:
73.38 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
RPS27A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S27a [Source:HGNC Symbol;Acc:10417]

Genomic region (view in browser)





>retro_opri_472
AGACTGATCTTGTCTGGCAAACAGCTGGAAGATGGACTATCTGACTACAACCTTCAAAAG
GAGCGCACACTGTGTCTTGTGTTGAGGCTTTGAGGCGGAGCTTAGAAAATGAAGTCATCT
CCATTCCCAGAAAGAACAGTCGTAAGAGAAAGGTGAAGCTGGCTGTCCTGCGTTATCATG
TACATGGGAATGACAGACTTAGTCCTGAGTGCCCCTCAGACGGATGAGGTGCTGGGAGGC
TTCCTGCTCAAGCCATTGTGACAGACATTATCCTGGCAAGCGTCATTTGACTCACTGCTT
CAATAAGCCAGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKS-YTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGA-GVFM-ASHFDR
RLI..GKQLEDG..LSDYN.QKE.T..L.L.LR......K.KS....P.KN..KRK.VKLAVL..Y.V..N....RL..ECPSD..GA.G.F...SH.DR
Retrocopy
RLILSGKQLEDG--LSDYNLQKERT--LCLVLRL*GGA*KMKS/ISIPRKNSRKRK-VKLAVLR-YHVHGN---DRLSPECPSDG*GA\GGFL\SSHCDR


Parental protein
HYCGKCCLTYCFNKPE
HY.GK..LT.CFNKP.
Retrocopy
HYPGKRHLTHCFNKPD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide