RetrogeneDB ID:
retro_opri_502
Organism:
Location:
scaffold_14152:23346-23673 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.82 %
Coverage:
95.58 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TMEM230
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 230 [Source:HGNC Symbol;Acc:15876]

Genomic region (view in browser)





>retro_opri_502
CCACGGCAGAGTGTGATGATGCCATTTCGCACTAACCTGGCTACTGGAATCCCCAGCAGT
AAGGTGAAGTACTCGCGACTCTCCAGCACAGACGATGGCTACATCGACCTCCAGTTTAAG
AAAAGCCCTCCGAAGATCCCGTACAAGGCCATCGCGCTCACCACCGTGCTGTTCCTGATC
GGTGCCTTTCTCATCATCATCGGCTCTCTCCTGCTGGCGGGCTACATCATCAAGGCGGGG
GCAGACCCAGCCGTTCCCGTGCTGATCACCAGCATCCTGGTGTGCCTGCCAGGATTTTAC
CACCTGCACATTGCCTACTGTGCATCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PRPRVMMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKSPPKIPYKAIALATVLFLIGAFLIIIGSLLLAGYISKGGTDWAI-VPILGILLHLPGFH
PR..VMMP.RTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKSPPKIPYKAIAL.TVLFLIGAFLIIIGSLLLAGYI.K.G.D.A..V.I..IL..LPGF.
Retrocopy
PRQSVMMPFRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKSPPKIPYKAIALTTVLFLIGAFLIIIGSLLLAGYIIKAGADPAVPVLITSILVCLPGFY


Parental protein
QLQVAFFVS
.L..A...S
Retrocopy
HLHIAYCAS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide