RetrogeneDB ID:
retro_opri_503
Organism:
Location:
scaffold_14222:42397-42709 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
94.23 %
Coverage:
99.05 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TAF12
Parental gene aliases:
No gene alias available
Parental gene description:
TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa [Source:HGNC Symbol;Acc:11545]

Genomic region (view in browser)





>retro_opri_503
TTGACGAAGAAGAAATTACAAGACTTGGTAAGAGAAGTGGATCCTAATGAGCAGTTGGAT
GAAGATGTGGGAGAGATGCTGCTGCAGCTGGCTGATGATTTCATTCAAAGTGTGGTGACA
GCAGCCTGCCAGCTTGCTCGGCATCGCAAGTCCAGTACCCTGGAGGTGAAAGATGTCCAA
CTTCATCTAGAACGCCAGTGGAACATGTGGATCCCAGGGTTTGGCTCCGAGGAAATCCGA
CCCTACAAGAAAGCCTGCACCGCAGAAGCCCACAAGCAGAGACTGGCACTTATCCGGAAA
ACAACGGAGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRK
LTKKKLQDLVREVDPNEQLDEDV.EMLLQ.ADDFI.SVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACT.EAHKQR.ALIRK
Retrocopy
LTKKKLQDLVREVDPNEQLDEDVGEMLLQLADDFIQSVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTAEAHKQRLALIRK


Parental protein
TTKK
TT.K
Retrocopy
TTEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide