RetrogeneDB ID:
retro_opri_524
Organism:
Location:
scaffold_1510:206046-206655 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.31 %
Coverage:
61.68 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RDH13
Parental gene aliases:
No gene alias available
Parental gene description:
retinol dehydrogenase 13 (all-trans/9-cis) [Source:HGNC Symbol;Acc:19978]

Genomic region (view in browser)





>retro_opri_524
GAAGAGCCCAGGCTGGATGTGTTGATCAACAATGCGGGAATCTTCCAGTGCCCTTACATG
AGGACCGAAGATGGGTTTGAGATGCAGTTTGGAGTGAACCACCTGGGGCACTTCCTACTC
ACCAATCTTCTCCTTGGCCTCCTGAAGAACTCAGCTCCCAGCAGGATCATCGTCGTTTCT
TCCAAACTTTATAAATATGGAGACATCAACTTTGACGACCTCAACAGTGAGCAGAGCTAC
AGTAAAAGCTTTTGCTACAGCCAAAGCAAACTGGCTAACATTCTTTTTACCAAAGAATTA
GCCCGCCGACTTGAAGGCACAAATGTCACTGTGAATGTACTGCATCCTGGGGTGGTGCGG
ACCAACCTCGGGCGGCACATCCACATCCCACTCTTGGTGAAGCCCCTTTTCAATTTGGTG
TCTTGGGCTTTTTTCAAAACTCCAGCAGAAGGTGCCCAGACTTCCATTTATTTGGCCTCT
TCCCCCGAGGTGGAAGGGGTGTCTGGAAGGTACTTTGGGGACTGTAAAGAGGAAGAGCTA
CTACCCAAAGCTATGGATGAGTCTGTTGCGCGGAAACTCTGGGACATCAGTGAAGTGATG
GTTGGCATA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EEERVDILINNAAVMRCPHWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQARRYDTKAAYCQSKLAVVLFTKE
EE.R.D.LINNA....CP...TEDGFEMQFGVNHLGHFLLTNLLL..LK.SAPSRII..SS.....G.I.FDDLN.....Y.....Y.QSKLA..LFTKE
Retrocopy
EEPRLDVLINNAGIFQCPYMRTEDGFEMQFGVNHLGHFLLTNLLLGLLKNSAPSRIIVVSSKLYKYGDINFDDLN-SEQSYSKSFCYSQSKLANILFTKE


Parental protein
LSRRLQGTGVTANALHPGVARTELGRHTGMHSSAFSSLTLGPIFWLLVKSPQLAAQPSTYLAVAEELEGVSGKYFDGLREKAAAPEAEDEEVARRLWAES
L.RRL.GT.VT.N.LHPGV.RT.LGRH...H.............W...K.P...AQ.S.YLA...E.EGVSG.YF....E....P.A.DE.VAR.LW..S
Retrocopy
LARRLEGTNVTVNVLHPGVVRTNLGRH--IHIPLLVKPLFNLVSWAFFKTPAEGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDIS


Parental protein
ARLVGL
...VG.
Retrocopy
EVMVGI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide