RetrogeneDB ID:
retro_opri_53
Organism:
Location:
GeneScaffold_1444:107893-108250 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.64 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS20
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S20 [Source:HGNC Symbol;Acc:10405]

Genomic region (view in browser)





>retro_opri_53
ATGGCCTTTAAGGATACCGGCAAGACGCCCGTGGAGCCCGAGGTGGCCATCCATTGCATC
AGGATCACGCTGACCAGCCGCAACGTCAAGTCCCTGGAGAAGGTGTGTGCTGCCTTGATC
AGAGGAGCAAAGGAGAAGAATCTGAAAGTGAAAGGACCAGTTCGGATGCCTACCAAGACT
TTGAGAATCACTACCAGAAAAACGCCCTGTGGGGAAGGGTCCAAGACCTGGGACTGCTTC
CAGATGAGGATCCACAAGCGGCTCATCGACCTGCACAGTCCTTCAGAGATTGTGAAGCAG
ATCACCTCCATCAGCATTGAGCCGGGAGTGGAGGTGGAGGTCACCATCACAGATGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQ
MAFKDTGKTPVEPEVAIH.IRITLTSRNVKSLEKVCA.LIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWD.FQMRIHKRLIDLHSPSEIVKQ
Retrocopy
MAFKDTGKTPVEPEVAIHCIRITLTSRNVKSLEKVCAALIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDCFQMRIHKRLIDLHSPSEIVKQ


Parental protein
ITSISIEPGVEVEVTIADA
ITSISIEPGVEVEVTI.DA
Retrocopy
ITSISIEPGVEVEVTITDA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide