RetrogeneDB ID:
retro_opri_538
Organism:
Location:
scaffold_159743:46-424 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.29 %
Coverage:
99.21 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
H2AFV
Parental gene aliases:
No gene alias available
Parental gene description:
H2A histone family, member V [Source:HGNC Symbol;Acc:20664]

Genomic region (view in browser)





>retro_opri_538
GCTGGTAATAAGGCTGGGAGGGACTCCGGAAACACCAAGACAAGGATGCTTTCCTGCTTG
CGGAGAGCTGGCTTGCAGTGCCCTATGGGTAGCATTCACCAATACCTGAAATCTAGGATG
ACCAGCCATGTGTATGTGGGCACGACTGTCACTGTGTATAGTACAGCCATTTTGGACAAC
CTCACCACAGAGGTACTTGGGCTGGCAAGACATGCATCAAAAGACCTAAAGTTAATGTGT
TTTACCCTGCATCACTTGCAAGTTGCTATTCGTGGAAATGAGGAAATGGACTCTCTCACC
AAGGCTATAATCACTAGTGGCAATGTCATCCCACACATCCACAAGTCTCTGATCGGGGAC
AAAGGACAACAGAAGACT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLI
AG.KAG.DSG..K....S...RAGLQ.P.G.IH..LK.R.TSH..VG.T..VYS.AIL..LT.EVL.LA..ASKDLK....T..HLQ.AIRG.EE.DSL.
Retrocopy
AGNKAGRDSGNTKTRMLSCLRRAGLQCPMGSIHQYLKSRMTSHVYVGTTVTVYSTAILDNLTTEVLGLARHASKDLKLMCFTLHHLQVAIRGNEEMDSLT


Parental protein
KATIAGGGVIPHIHKSLIGKKGQQKT
KA.I..G.VIPHIHKSLIG.KGQQKT
Retrocopy
KAIITSGNVIPHIHKSLIGDKGQQKT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide