RetrogeneDB ID:
retro_opri_577
Organism:
Location:
scaffold_17951:4396-4657 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.78 %
Coverage:
55.28 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CHMP1B
Parental gene aliases:
No gene alias available
Parental gene description:
charged multivesicular body protein 1B [Source:HGNC Symbol;Acc:24287]

Genomic region (view in browser)





>retro_opri_577
GCGGTGGCCGCCAGGGTGCAGACGGCCGTGACGATGGGCAAGGTGACCAAGTCGATGGCC
GGCGTGGTGAAGTCCATGGACGCGACGCTCAAGACCATGAACCTCGAGAAGATCTCGGCC
CTGATGGACAAGTTCGAGCACCAGTTCGAGACGCTGGACGTGCAGACGCAGCAGATGGAA
GACACGATGAGCAGCACGACGACGCTGACCACTCCCCAGAACCAGGTGGATCTGCTGCTC
CAGGAAATGGCCGACGAGGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AVSARVQPAVTTGKVRLKRQRCVVKSMDATLRSRTLRRKISALMDKFEHQFETLDVQTQQMEDTMSNTTTLTTPQNEVDTLLQEMADEA
AV.ARVQ.AVT.GKV..K....VVKSMDATL....L..KISALMDKFEHQFETLDVQTQQMEDTMS.TTTLTTPQN.VD.LLQEMADEA
Retrocopy
AVAARVQTAVTMGKVT-KSMAGVVKSMDATLKTMNLE-KISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDLLLQEMADEA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide