RetrogeneDB ID:
retro_opri_582
Organism:
Location:
scaffold_181781:19-343 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.76 %
Coverage:
72.73 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS27A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S27a [Source:HGNC Symbol;Acc:10417]

Genomic region (view in browser)





>retro_opri_582
ATCTTTGCTAGCAAGCTCTCTGGAAAGTAGATGAGCTTTATCTGACTATAGCATTATAAA
GAACTTCTCTCTTGATCTTGTGTTGAGACTTCACAACAGTGCTAAGGAAAGGGAGAAGTC
TTCCACCACTCATGAGAAAAGTGAGCATGCAAGGAAGAAGTTAAGCTAGGTTGCTTGAAG
CACCATGAGGTGGATGAGAATGGTAAAAATTAGTTTCCTGCATGGCCAGTGCTGTTTGGA
TGAATGTGGTGCTGGAAATTTTAGGGCACTTAGACAGTATTGTGGCAATGTTGTCTAACT
TACTGCTTCAACAAAGCATAGGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IFAGK-QLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKK-VKLAVLKYYKVDENGK-ISRLRRECPSDECGAGVFMASHFDRHY
IFA.K..LE....LSDY.I.K...L.LVLRL...AK.R.K.S.TT..K..H.RKK.VKL..LK...VDENGK.IS.L...C..DECGAG.F.A....R.Y
Retrocopy
IFASK\SLESR*ALSDYSIIKNFSLDLVLRLHNSAKEREKSS-TTHEKSEHARKK/VKLGCLKHHEVDENGK\ISFLHGQCCLDECGAGNFRAL---RQY


Parental protein
CG-KCCLTYCFNKPED
CG..CCLTYCFNK..D
Retrocopy
CG/QCCLTYCFNKA*D


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide