RetrogeneDB ID:
retro_opri_6
Organism:
Location:
scaffold_635:71566-73723 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
54.14 %
Coverage:
79.76 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SLC5A1
Parental gene aliases:
No gene alias available
Parental gene description:
solute carrier family 5 (sodium/glucose cotransporter), member 1 [Source:HGNC Symbol;Acc:11036]

Genomic region (view in browser)





>retro_opri_6
ATGAGGGCTGTACTGGAGACAGCAGACATTGCCATAGTGGCCCTGTATTTTATCCTGGTC
ATGTGCATTGGGTTTTTTGCCATGTGGAAATCTAATAGAAGCACCGTAAGTGGATACTTC
CTGGCGGGGCGCTCTATGACCTGGGTAGCCATTGGTGCCTCTCTGTTTGTGAGCAATATT
GGGAGTGAGCACTTCATTGGGCTGGCAGGATCTGGAGCGGCAAGCGGATTCGCAGTGGGT
GCTTGGGAGTTCAATGCCTTACTGCTTTTGCAACTTTTGGGATGGGTTTTCATCCCAATT
TACATCCGGTCGGGGGTATACACCATGCCTGAATACTTGTCCAAGCGATTCGGTGGCCAT
AGGATTCAGGTCTACTTTGCAGCCTTGTCTCTGATTCTCTATATCTTCACCAAGCTCTCA
GTGGATCTGTATTCAGGCGCCCTCTTTATCCAGGAGTCTTTGGGTTGGAACCTTTATGTG
TCTGTCATCCTGCTCATTGGCATGACTGCTTTACTGACTGTCACCGGAGGCCTTGTTGCA
GTGATCTACACAGACACCTTACAGGCCCTGCTCATGATTGTTGGGGCCCTCACACTTATG
ATTATAAGCATGATGGAGGTTGGCGGGTTTGAGGAAGTTAAGAGAAGGTACATGTTGGCC
TCACCCAACGTCACGTCCATCTTGTTGACATACAACCTTTCAAACACAAATTCTTGTAAT
GTCCAGCCTAAGAAAGATGCCTTGAAAATGTTGAGGAATCCAACAGATGAAGATGTTCCG
TGGCCTGGATTCATACTTGGACAGACCCCCGCCTCAGTGTGGTATTGGTGTGCTGACCAA
GTCATCGTGCAGAGGGTCCTAGCTGCCAAAAACATTGCTCATGCCAAAGGCTCTACTCTT
ATGGCTGGCTTCTTGAAGCTTCTGCCAATGTTTATCATAGTTGTCCCAGGAATGATTTCC
AGGATACTGTTTGCTGATGATCTAGCTTGCATCAACCCAGAGCACTGCATGCAGGTGTGT
GGAAGCAGAGCCGGGTGCTCTAATATCGCTTACCCACACCTGGTGATGAAGCTGGTTCCT
GTGGGCCTTCGGGGCTTAATGATGGCGGTGATGATTGCAGCTCTCATGAGTGACCTGGAC
TCTATCTTTAACAGTGCCAGTACCATATTCACCCTTGATGTGTACAAACTCATCCGCAAG
AGTGCAAGTTCCCGGGAGCTAATGATTGTGGGGAGGATATTTGTGGCTTTTATGGTGGTT
ATCAGCATAGCATGGGTGCCGATCATCGTGGAGATGCAAGGAGGCCAGATGTACCTTTAC
ATCCAGGAGGTGGCAGATTACCTGACACCTCCGGTGGCAGCCCTGTTCCTTCTGGCAATT
TTCTGGAAGCGCTGCAATGAACAAGGGGCTTTCTACGGAGGAATGGCTGGATTTGTGCTT
GGAGCAGTCCGTTTGATACTGGCTTTTACATACCGTGCCCCGGAATGTGACCAGCCTGAT
GAGAGACCCAGTTTCATCAAAGACATCCATTACATGTATGTGGCCACAGCATTGTTCTGG
ATCACAGGACTCATTACTGTGATTGTTAGCCTCCTCACCCCACCTCCCACGAAGGAGCAG
ATTCGCACCACCACCTTTTGGTCCAAGAAGAACCTGGTGGTGAAGGAGAGCTGCTCTGCC
AGAGAGGAACTGTACAAAATGCAGGAGAAGAGCATGCTGAAGTGCAGTGAGAATAGTGAG
GCCATCAACCACATCATTCCCAATGGGAAATCTGAAGATAGCATCAAAGGCCTTCAGCCA
GAAGACGTCAATCTGTTGGTGACCTGCCGAGAGGAGGCCAACCCAGTGGCATCCGTGGGC
CACTCTGAGGCAGAAACACCAGTAGATGCTTATTCCAATGGGCAAGCAGCTCTCATGGGA
GAGAAAGAGAGAAAGAAGGAAATGGAGGCTGGCAGCCGCTACTGGAAGTTCATAGACTGG
TTTTGCGGCTTTAAGAGTAAGAGTGTCAGCAAGAGGAGTCTCAGAGACCTCATGGAGGAG
GAGGCTGTTTGTTTACAGATGTTAGAGGAGACTCCCAGAGTAAAGCTGATACTCAACGTT
GGACTTTGTGCTGTGTGTTCACTTGGAATTTTCATGTTTGTCTATTTCTCCTTATGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IRNAADISVIVIYFLVVLAVGLWAMLSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIATGGFEWNALIMVIVLGWVFVPIYIK
....ADI.....YF..V...G..AM...NR.TV.G.FLAGRSM.W..IGASLF.SNIGS.HF.GLAG.GAASG.A.G..E.NAL.....LGWVF.PIYI.
Retrocopy
VLETADIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIR


Parental protein
AGVVTMPEYLQKRFGGKRIQIYLSVLSLLIYIFTKISADIFSGAIFIQLALGLDLYVAIIVLLVITGIFTITGGLSAVIYTDALQTLIMLVGSCILVGFA
.GV.TMPEYL.KRFGG.RIQ.Y...LSL..YIFTK.S.D..SGA.FIQ..LG..LYV..I.L...T...T.TGGL.AVIYTD.LQ.L.M.VG...L....
Retrocopy
SGVYTMPEYLSKRFGGHRIQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIVGALTLMIIS


Parental protein
FHEVGGYDAFTEKYMQAIP---SVTSEGNFSASQECYT-PREDAFHIFRDAITGDIPWPGLVFGMSILTLWYWCTDQVIVQRCLSAKNMSHVKAGCIMCG
..EVGG.......YM.A.P...S.....N.S....C...P..DA....R.....D.PWPG...G......WYWC.DQVIVQR.L.AKN..H.K....M.G
Retrocopy
MMEVGGFEEVKRRYMLASPNVTSILLTYNLSNTNSCNVQPKKDALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAG


Parental protein
YLKILPMFLIIMMGMISRILYTDRIACVVPSECERYCGTRVGCTNIAFPILVVELMPNGLRGLMLSVMMASLISSLTSVFNSASTLFTMDLYTKIRNKAS
.LK.LPMF.I...GMISRIL..D..AC..P..C...CG.R.GC.NIA.P.LV..L.P.GLRGLM..VM.A.L.S.L.S.FNSAST.FT.D.Y..IR..AS
Retrocopy
FLKLLPMFIIVVPGMISRILFADDLACINPEHCMQVCGSRAGCSNIAYPHLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSAS


Parental protein
ERELMIVGRVFMLFLIAVSIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAALFLLAIFWKRTNEPGAFWGLIFGFLVGISRMIAEFAYGTGSCVEPSNCP
.RELMIVGR.F..F....SIAWVPI....Q.GQ...YIQ....YL.PP.AALFLLAIFWKR.NE.GAF.G...GF..G..R.I..F.Y....C..P...P
Retrocopy
SRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFTYRAPECDQPDERP


Parental protein
TIICGVHYLYFAIILFVISIIVTVAVSLFTKP
..I...HY.Y.A..LF.I....TV.VSL.T.P
Retrocopy
SFIKDIHYMYVATALFWITGLITVIVSLLTPP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide