RetrogeneDB ID:
retro_opri_608
Organism:
Location:
scaffold_19189:7180-7507 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.45 %
Coverage:
52.94 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_opri_608
TCTGGGGCCAACAGTCCCGTCAAGGAATGCTTCACCCTGTGTGCTCTGGGGACCCGAGAG
CATTGGGATGCTGTCTACAAGAAAGAATTACAGACAATCCGGGAATGTGGGGATACAGGA
GAGATCTGGTTTGGAGAAGAGAGCATGACTCGACTGATGAGGTGGATGCAGACACAGAAG
GTTCCATTGGATGCCTCAGTGCTGGCTATTGGAAATGGAACTGATGTTTTTTTGGTTGAA
CTTGCAAAATTTGATTTCAGTAATATTACTGGAATTGATTACTCTCCCTCAGCATTTCAA
CTTTCTGGAAGCATCCTAGAGAAAGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AGARSPAEDGFAPSALGTREHWDAVYERELQTFQECGDTGEIWFGEESMTRLLRWMQKRKVPLDASVLDIGTGNGVFLVELXAKFGFHNITGI-YSPSAI
.GA.SP....F...ALGTREHWDAVY..ELQT..ECGDTGEIWFGEESMTRL.RWMQ..KVPLDASVL.IG.G..VFLVEL.AKF.F.NITGI.YSPSA.
Retrocopy
SGANSPVKECFTLCALGTREHWDAVYKKELQTIRECGDTGEIWFGEESMTRLMRWMQTQKVPLDASVLAIGNGTDVFLVEL-AKFDFSNITGIDYSPSAF


Parental protein
Q-SGNILEKE
Q.SG.ILEKE
Retrocopy
QLSGSILEKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide