RetrogeneDB ID:
retro_opri_628
Organism:
Location:
scaffold_20215:10662-11025 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.56 %
Coverage:
95.93 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL35
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L35 [Source:HGNC Symbol;Acc:10344]

Genomic region (view in browser)





>retro_opri_628
ATGGCCAAGATCAAGGCTCGGGACCTCCGCGGCAAGAAGAAGAAGAAGGAGGAGCTGCTG
AAGCAGCTGGACGACCTCAAAATGGAGCTGTTGCAGCTGCGCGTCGCCAAGGTCACCGGC
GGCGCGGCGTCCAAGCTGTCGAAGATCCGCGTTGTCGGCAAGTCCATCACCCGGGTGCTC
ACGGTCATCAACCAGACCCAGAAAGAAAACCTAAGGAAGTTCTACAAGGGCAAGAAGTAT
AAGCCCCTGGACCTGCGGCCCAAGAAGACGCGCGCCATGCGCCGCCGCCTCAACAAGCAC
GAGGAGAACCTCAAGACCAAGAAGCAGCAGCAGCGGAAAGAGCGGCTGTACCCGAAAGAG
AAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAKIKARDLRGKKK--EELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKH
MAKIKARDLRGKKK..EELLKQLDDLK.EL.QLRVAKVTGGAASKLSKIRVV.KSI.RVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKH
Retrocopy
MAKIKARDLRGKKKKKEELLKQLDDLKMELLQLRVAKVTGGAASKLSKIRVVGKSITRVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKH


Parental protein
EENLKTKKQQ-RKERLYPLRK
EENLKTKKQQ.RKERLYP..K
Retrocopy
EENLKTKKQQQRKERLYPKEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide