RetrogeneDB ID:
retro_opri_630
Organism:
Location:
scaffold_2035:13257-13470 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.11 %
Coverage:
92.31 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PDRG1
Parental gene aliases:
No gene alias available
Parental gene description:
p53 and DNA-damage regulated 1 [Source:HGNC Symbol;Acc:16119]

Genomic region (view in browser)





>retro_opri_630
GGGAGCATATTTATCAGGATGGTGCACCCTCCGACCAAGGAAGTGATAAAGAAAGATCAG
GATATTTGGAAACAGAAAGGACAAACTGCAGAACGAATTAAAGTGGAAATCAACCTCCTC
TTTGAGGCCCAAGACAAGCCAGAGCTGAAGGACTTTAACCTGAACTCCCTCAACCAGGAT
GAGCTTAAAGCTCTCAATATCATCTTGAAAGGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GSMFIKMPHPQTKEMIEKDQDHLDKEIDRLRKQLKVKVSRLLEAQGKPELKGFNLNPLNQDELKALKVILKG
GS.FI.M.HP.TKE.I.KDQD...K.........KV....L.EAQ.KPELK.FNLN.LNQDELKAL..ILKG
Retrocopy
GSIFIRMVHPPTKEVIKKDQD-IWKQKGQTAERIKVEINLLFEAQDKPELKDFNLNSLNQDELKALNIILKG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide