RetrogeneDB ID:
retro_opri_655
Organism:
Location:
scaffold_22185:4629-5400 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.33 %
Coverage:
78.59 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SEPHS1
Parental gene aliases:
No gene alias available
Parental gene description:
selenophosphate synthetase 1 [Source:HGNC Symbol;Acc:19685]

Genomic region (view in browser)





>retro_opri_655
GAAAGGGATAAAGTGATCCCCCTAATTAAACAGGGCTTTGAAGATGCAGCAGAGGAAACA
GGAACATCGGTAACCGGTGGCCAAATGGTGTTAAACCCCTTGATGGTTTTGGGAGGAGTC
GCTACAACTGTCTGCCAGCCCAATGAATTTATCATGCCAGATAATGCAGTGCCAGGAGAT
GTGTTGGTGTTAACGAAACCCCTGGGGACGCAAGCTGGTGTCGCAGTGCATCAGTGGCTG
GACATTCCTGAAAAATGGAATAAAATTAAATTAGTGGCCACCCAAGAAAATGTGGATATG
GCTTACCAAGAAGCGATGATAAATATGCCCAGGCTCAACAGAACAGCTGCAGGACTCATG
CACACATTCAACGCCCATGCTGCCACCGACATCACCGGCTTCGGGATTTGGGGACTCGCA
CAGAACCTAGTCATGCAGCAGAGGAACGAGGTGTCATTTGTGATTCACAACCTCCCTGTG
CTGGCGAAGATGGCTGTTGTGAGCAAGGCCCGTGGAAGCATGTTTGGCCTCATGCATGGG
ACCTGTCCGGAGACAACAGGAGGCCTTCTAATCTGTTTACCACATGAGCAAGCAGTTCGT
TTCTGTGCAGAGATAAAGTCCCCCAAATATGGTGAAGCTCACCAAGCATGGATTATTGGG
ATTGCAGAGAAGGGCAACCGTACCGCCAGGATCATACACAAACCCCGGATCACTGAAGTG
GCACCACAAGTGGCCACTCCGAATGTGAACCCCATGCCCGGTGCCACCTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ERDKVIPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVEL
ERDKVIPLI.QGF.DAAEE.GTSVTGGQ.VLNP..VLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQ..VAVHQWLDIPEKWNKIKLV.TQE.V..
Retrocopy
ERDKVIPLIKQGFEDAAEETGTSVTGGQMVLNPLMVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQAGVAVHQWLDIPEKWNKIKLVATQENVDM


Parental protein
AYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAAR
AYQEAM.NM.RLNRTAAGLMHTFNAHAATDITGFGI.G.AQNL..QQRNEVSFVIHNLPVLAKMA.VSKA.G.MFGLMHGTCPET.GGLLICLP.EQA.R
Retrocopy
AYQEAMINMPRLNRTAAGLMHTFNAHAATDITGFGIWGLAQNLVMQQRNEVSFVIHNLPVLAKMAVVSKARGSMFGLMHGTCPETTGGLLICLPHEQAVR


Parental protein
FCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS
FCAEIKSPKYGE.HQAWIIGI.EKGNRTARII.KPRI.EVAPQVAT.NVNP.PGATS
Retrocopy
FCAEIKSPKYGEAHQAWIIGIAEKGNRTARIIHKPRITEVAPQVATPNVNPMPGATS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide