RetrogeneDB ID:
retro_opri_681
Organism:
Location:
scaffold_23753:7911-8226 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
97.14 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TXN
Parental gene aliases:
No gene alias available
Parental gene description:
thioredoxin [Source:HGNC Symbol;Acc:12435]

Genomic region (view in browser)





>retro_opri_681
ATGGTGAAACAGATTGAGAGCAAGCCCGCTTTTCAGGAAGTGTTGGCCTCTGCAGGAGAT
AAGCTAGTTGTGGTTGACTTCTCAGCCACGTGGTGCGGACCCTGCAAGATGATCAAGCCA
TTCTTTCATTCCCTCTCTGAAAAATATTCCAACGTGCTGTTTATTGAAGTAGATGTGGAT
GACTGCCAGGATATCGCTGCAGACTGGGAAGTCAAGTGCATGCCCACCTTCCAGTTTTTT
AAGAAGGGCCAGAAGGTGGGTGAATTTTCTGGAGCAAATAAGGAAAAACTTGAAGCCACC
ATTAATGAACTACTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVKQIESKSAFQEVLDSAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVLFIEVDVDDCQDIAADCEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT
MVKQIESK.AFQEVL.SAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVLFIEVDVDDCQDIAAD.EVKCMPTFQFFKKGQKVGEFSGANKEKLEAT
Retrocopy
MVKQIESKPAFQEVLASAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVLFIEVDVDDCQDIAADWEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT


Parental protein
INELL
INELL
Retrocopy
INELL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide