RetrogeneDB ID:
retro_opri_71
Organism:
Location:
GeneScaffold_180:38991-39374 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
54.81 %
Coverage:
85.06 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
RPS27A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S27a [Source:HGNC Symbol;Acc:10417]

Genomic region (view in browser)





>retro_opri_71
AACAGAAACCATAAGGACAAAGATCCAGAATAAGGAAAGCCCACTGGTCAGCTATGACCC
ATCTTTGCTAGCAAGCTCCTGGAAAGTAGATGAGCTTTATCTGACTATAGCATTATAAAG
AACTTCTCTCTTGATCTTGTGTTGAGACTTCACAACAGTGCTAAGGAAAGGGAGAAGTCT
TCCACCACTCATGAGAAAAGTGAGCATGCAAGGAAGAAGTTAAGCTAGGTTGCTTGAAGC
ACCATGAGGTGGATGAGAATGGTAAAAATTAGTTTCCTGCATGCCCAGTGCTGTTTGGAT
GAATGTGGTGCTGGAAATTTTAGGGCACTTAGACAGTATTGTGGCAATGTTGTCTAACTT
ACTGCTTCAACAAAGCATAGGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKK-VKLAVLKYYKVDENGK-ISRLRREC
N...K..D.E.G.P..Q...IFA.K.LE....LSDY.I.K...L.LVLRL...AK.R.K.S.TT..K..H.RKK.VKL..LK...VDENGK.IS.L...C
Retrocopy
NRNHKDKDPE*GKPTGQL*PIFASKLLESR*ALSDYSIIKNFSLDLVLRLHNSAKEREKSS-TTHEKSEHARKK/VKLGCLKHHEVDENGK\ISFLHAQC


Parental protein
PSDECGAGVFMASHFDRHYCG-KCCLTYCFNKPED
..DECGAG.F.A....R.YCG..CCLTYCFNK..D
Retrocopy
CLDECGAGNFRAL---RQYCG/QCCLTYCFNKA*D


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide