RetrogeneDB ID:
retro_opri_714
Organism:
Location:
scaffold_253:170435-170828 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
50.38 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
UBL4A
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-like 4A [Source:HGNC Symbol;Acc:12505]

Genomic region (view in browser)





>retro_opri_714
ATGTTACTCACAGTCAAGCTTCTCCTGGGCCGGCGATGCAGTGTGAAGGTGTCGGGGCAA
GAGAGTGTGGCCGCACTGAAGAAGCTGGTGTCACAGCAGCTACAGGTGCCTGAGGAGCAG
CAGCACCTGCTGTTTCGTGGCCAGCTCCTGGCAGATGACAAGTGCCTCTCGGATTACTGC
ATTGGGCCCAATGCCTCCATCAACGTCATTGTGCGGCCCCTGGAGAAGATAGAGCTGGAG
AACGCTCACCAGCCCCAGCCCCAGCCCCTGTGGCAGCAGCTGGACCGGGTCCTGGCCAGA
CACTTTGGGCTGCAGGATGCCAAGGCTGTGCTGCAGCTGCTGAGACAAGAGCATGAGGGG
CGCCTGCAGAGGGTAAGCCTACAGGACCTGGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQLTVKALQGRECSLQVPEDEQVSTLKQLVSERLNVPVHQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVVL--AADSPPPPVWQLISKVLAR
M.LTVK.L.GR.CS..V...E.V..LK.LVS..L.VP..QQ.LLF.G..LAD.K.LSDY.IGPN...N..V.PLEK..L..A........WQ....VLAR
Retrocopy
MLLTVKLLLGRRCSVKVSGQESVAALKKLVSQQLQVPEEQQHLLFRGQLLADDKCLSDYCIGPNASINVIVRPLEKIELENAXXXXXXXXWQQLDRVLAR


Parental protein
HFSAADASRVLEQLQRDYERSLSRLTLDDIE
HF...DA..VL..L....E..L.R..L.D.E
Retrocopy
HFGLQDAKAVLQLLRQEHEGRLQRVSLQDLE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide