RetrogeneDB ID:
retro_opri_727
Organism:
Location:
scaffold_26466:4451-4817 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.08 %
Coverage:
90.15 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TBCA
Parental gene aliases:
No gene alias available
Parental gene description:
tubulin folding cofactor A [Source:HGNC Symbol;Acc:11579]

Genomic region (view in browser)





>retro_opri_727
CCGGAGCGCCCCGCCCCTGCTCGTGCGCGGCGCTCCGGGGCCATGGCCGACCCTCGTGTG
CGGCAGATCAAGATCAAGACCGGCGTGGTGAAGCGATTGGTCAAAGAAAAAGTGATGTAC
GAGAAGGAAGCAAAACAGCAAGAAGAAAAGATTGAAAAGATGAAAGCTGAAGACGGTGAA
AATTATGCCATTAAGAAGCAGGCCGAGATCCTGCAGGAGTCGCGCATGATGATCCCCGAC
TGCCAGCGCAGGCTGGAGGCTGCCTACGCCGACCTGCAGCAGGTCCTGGAAAGTGAAAAA
GACTTGGAAGAAGCTGAAGAGTATAAAGAAGCACGGGTGGTCCTGGACTCAGTGAAGCTG
GAAGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PRRPAPAR-RGAGAMADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQESRMMIPDCQRRLEAAYADLQQ--ESEK
P.RPAPAR.R..GAMADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQESRMMIPDCQRRLEAAYADLQQ..ESEK
Retrocopy
PERPAPARARRSGAMADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQESRMMIPDCQRRLEAAYADLQQVLESEK


Parental protein
DLEEAEEYKEARVVLDSVKLEA
DLEEAEEYKEARVVLDSVKLEA
Retrocopy
DLEEAEEYKEARVVLDSVKLEA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide