RetrogeneDB ID:
retro_opri_728
Organism:
Location:
scaffold_26472:39168-39486 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.08 %
Coverage:
60.57 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CBX3
Parental gene aliases:
No gene alias available
Parental gene description:
chromobox homolog 3 [Source:HGNC Symbol;Acc:1553]

Genomic region (view in browser)





>retro_opri_728
AATACTTGGGAACGTGAAGAAAATTTAGATTGTCCAGAGTTAACTGAAGACTGTCTTAAT
TTTCAAACACCTGATAAAGAAAAAGATGGTACAAAAAGAAAATCTTTATCTGACAGTGAA
TCTGATGACAGCAAACCAAAGAAGAAAAGAGATGCTGCTGACAAACCAACAGGCTTTGCC
AAAGGTCTTGATCCTGAACGAATAATTGGTGCCACAGACAGCAATGCAGAATTGATGTTT
GTCATGAAATGGGAAAATTCACATGAGGCTGACTTGGTGCTGGCAAAAGAAGCAAATATG
AAATGTCCTCAGACTGTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NTWEPEENLDCPELIEAFLNSQKAGKEKDGAKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANM
NTWE.EENLDCPEL.E..LN.Q...KEKDG.KRKSLSDSESDDSK.KKKRDAADKP.GFA.GLDPERIIGATDS..ELMF.MKW..S.EADLVLAKEANM
Retrocopy
NTWEREENLDCPELTEDCLNFQTPDKEKDGTKRKSLSDSESDDSKPKKKRDAADKPTGFAKGLDPERIIGATDSNAELMFVMKWENSHEADLVLAKEANM


Parental protein
KCPQIV
KCPQ.V
Retrocopy
KCPQTV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide