RetrogeneDB ID:
retro_opri_73
Organism:
Location:
GeneScaffold_1874:94428-94830 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
90.3 %
Coverage:
60.63 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
AK4
Parental gene aliases:
No gene alias available
Parental gene description:
adenylate kinase 4 [Source:HGNC Symbol;Acc:363]

Genomic region (view in browser)





>retro_opri_73
TTTCCTAGGACACTAGTACAGGCTGAAGCTCTAGACAAAATTTGTGACCTGGATCTAGTG
ATCACTTTGAACATTCCGTTTGAGACACTGAAAGATCGGCTCAGCCGTCGTTGGATTCAC
CCTCCCAGCGGAAGAGTGTATAACATGGACTTCAACCCGCCTCATGTGCATGGAATTGAT
GACATCACTGGTGAATCATTAGTCCAACAAGAGGATGATAAGCCTGAAGCAGTTGCTGCC
CGGCTAAGACGGTATAAGGACGCTGCGAAGCCAGTCATTGAGCTATACAAGAGCTGGGGG
GCGCTCCACCAGTTTTGGGGGATGGAGACTAATAAAATCTGGCCTTATGTTTACATGCTT
TTCTCAAACAAGATCACACCTGTTCAGCCCAGGCAGGCATAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FPRTLAQAEALDKICDLDLVITLNIPFETLKDRLSRRWIHPPSGRVYNMDFNPPHVHGIDDITGEALIQQEEDKPEAVAARLRRYKDTAKPVIELYKSRG
FPRTL.QAEALDKICDLDLVITLNIPFETLKDRLSRRWIHPPSGRVYNMDFNPPHVHGIDDITGE.L.QQE.DKPEAVAARLRRYKD.AKPVIELYKS.G
Retrocopy
FPRTLVQAEALDKICDLDLVITLNIPFETLKDRLSRRWIHPPSGRVYNMDFNPPHVHGIDDITGESLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSWG


Parental protein
VLHQFSGTETNKIWPYVYTLFSNKITPVKRRQAF
.LHQF.G.ETNKIWPYVY.LFSNKITPV..RQA.
Retrocopy
ALHQFWGMETNKIWPYVYMLFSNKITPVQPRQAY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide