RetrogeneDB ID:
retro_opri_732
Organism:
Location:
scaffold_26751:8051-8534 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.17 %
Coverage:
60.38 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
NSMCE1
Parental gene aliases:
No gene alias available
Parental gene description:
non-SMC element 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:29897]

Genomic region (view in browser)





>retro_opri_732
ATGCAGGAGAGTGCGAGAAAGCCGGGAGTCATGACCGACGTCCACCGGGGGTTCCTGCAG
CTGCTGATGACTCCCGGCGTGCTGGAGGAGTGGGAAGTGGAGCGTATACAGAGACACTGC
TACAAGGTCCACGGCCGCAACGCTCCTGTGGAGAAGCTGGAGGACTTCATCTACACCGTC
AACAGTGCCTTGCAGTCTCTCTACATGGAGATCAAGAAAGGAGTCACGGAAGACGACGGC
CGACCCATTTATGCACTGGTGAACCTCACCACCACGCCCATTTCCAAAATGGCCACGGAT
TTTGCTAAGAACGAACTGGACCTATTCAGAAAGGCGCTGGAGCTGATCACCGACTCTGAA
ACGGGCTTTGCGTCCTCCACCAACATCCTGAACCTGGTCGATCAGCTGAAAGGCAAGAAG
ATGAAGAAGAAGGAGGCCGAGCAGGTGCTGCAGAAGTTCGTGCAGAGCAAATGGCTGATC
GAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQGSARKPGVMTDVHRRFLQLMMTHGVLEEWEVERLQRHCYKVHDRNAPVDKLEDFIYTINSALQSLYMEIKKGVTEDDGRPIYALVNLTTTPISKMATD
MQ.SARKPGVMTDVHR.FLQL.MT.GVLEEWEVER.QRHCYKVH.RNAPV.KLEDFIYT.NSALQSLYMEIKKGVTEDDGRPIYALVNLTTTPISKMATD
Retrocopy
MQESARKPGVMTDVHRGFLQLLMTPGVLEEWEVERIQRHCYKVHGRNAPVEKLEDFIYTVNSALQSLYMEIKKGVTEDDGRPIYALVNLTTTPISKMATD


Parental protein
FAKNELDLLR-GLELITDSETGFASSTNILNLVDQLKGKKMKKKEAEQVLQKFVQSKWLIE
FAKNELDL.R..LELITDSETGFASSTNILNLVDQLKGKKMKKKEAEQVLQKFVQSKWLIE
Retrocopy
FAKNELDLFRKALELITDSETGFASSTNILNLVDQLKGKKMKKKEAEQVLQKFVQSKWLIE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide