RetrogeneDB ID:
retro_opri_764
Organism:
Location:
scaffold_2939:159383-159710 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
89.09 %
Coverage:
54.19 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL13A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L13a [Source:HGNC Symbol;Acc:10304]

Genomic region (view in browser)





>retro_opri_764
CGGGGTCAGGCCGCCCTGGAGTGCCTAAAGGTGTTTGATGGCATCCCACCACCCTACGAC
AAGAAAAAGCGGATGGTGGTGCCTGCGGCCCTCAAGGTTGTGCGCCTGAAGCCCACGAGG
AAGTTTGCTTACCTGGGACGCCTGGCTCACGAGGTTGGCTGGAAGTACCAGGCGGTGACG
GCCACGCTGGAGGAGAAGCGGAAGGAGAAGGCCAAGATGCATTACCGCAAGAAGAAGCAG
CTGATGAGGCTACGGAAACAGGCCGAAAAGAACGTGGAGAAGATCAACAAGTTCATAGAG
GTCCTCAAGACCCACGGCCTCCTGGTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RGQAALERLKVFXXXXXXXXXKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVEKKINKFT
RGQAALE.LKVF.........KKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVEK.INKF.
Retrocopy
RGQAALECLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVEK-INKFI


Parental protein
EVLKTHGLLV
EVLKTHGLLV
Retrocopy
EVLKTHGLLV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide