RetrogeneDB ID:
retro_opri_805
Organism:
Location:
scaffold_31771:599-911 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
85.71 %
Coverage:
57.38 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
COMMD8
Parental gene aliases:
No gene alias available
Parental gene description:
COMM domain containing 8 [Source:HGNC Symbol;Acc:26036]

Genomic region (view in browser)





>retro_opri_805
ATGGGGCCAGAAGAGGGGATACCCTTGTGGTGGCTGCAGAAGCTGCTGGCTGAGCTGGGC
CCACAGCTTCTTCACAAAGTAGTGGATGGCATTTGTGGCCAAACTTACCCTCTCCACCAG
GACTATCATGTTTGGGATTCCACAGAATGGAAGCATGTTCTAGAAGATATCACTCAATTT
TTCAAAGCTGTTGTGGGTAAAAACTTATCTGATGAAGAGGTATTCCAGCAGTTGAATCAA
TTGAATTCATCTCATCAACAAGGTATCATGAAGTGCTTGAAAAACAGGAAAGATGAAATC
AAGCAGACTATT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEPEEGTPLWRLQKLPAELGPQLLHKVLDGICGRAYPLHQDYHDVWDSTEWKHVLEDITQFFKAVVGKNLSDEEVSQQLNQLSSSHQQAIMKCLRSRKDE
M.PEEG.PLW.LQKL.AELGPQLLHKV.DGICG..YPLHQDYH.VWDSTEWKHVLEDITQFFKAVVGKNLSDEEV.QQLNQL.SSHQQ.IMKCL..RKDE
Retrocopy
MGPEEGIPLWWLQKLLAELGPQLLHKVVDGICGQTYPLHQDYH-VWDSTEWKHVLEDITQFFKAVVGKNLSDEEVFQQLNQLNSSHQQGIMKCLKNRKDE


Parental protein
VKQTL
.KQT.
Retrocopy
IKQTI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide