RetrogeneDB ID:
retro_opri_808
Organism:
Location:
scaffold_32187:41328-42084 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.63 %
Coverage:
71.92 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_opri_808
CCTTTCCAGCTCACTGTGAAAAAGCTGGAGCAAGCCATGGTTGAAGCTAGACTCAAGGGG
AAAAGAGTCAAAGGCCTCGTGCTAGTCAACCCACAGAATCCTCTGGGTGGCATCTACTCC
CAAGAGTCACTGAAGGAATACCTGGAATTTGCCAAGAGGAATTACTTGCATGTGATCATG
GATGAGATTTACATGCTCACTGTGTTTGATGACTCTCTCAAGTTCCACAGCGTGCTGAGC
ATAGAAAGCTGGCCTGACCCCAACAGGACCCACGTGATCTGGGGAACTAGTAAGGATTTT
GGCATCTCTGGCTTCCGCTTTGGTGCTCTGTACACCCACAACAAGGATGTGGCCTCTGCC
GTGTGCTCCTTTGGCTACCTCCACAGTACCTCTGGCACCGCCCAGTACAAACTACACCGC
CTGCTCCAAGACACAGAATGGATCAACACAGTGTACCTGCCGACCAACCTCTCACAGCTC
AGGAAGGCCTACAATTATGTCACTGGTCAGCTGAAGCTATTGGGAATCCCGTTTCTCAGT
GGTGGCGCTGGCCTCTACATCTGGATCAACTTGAAGTCGTACCTAGAACCATGTACATTT
GATGAAGAACTGGCCCTCCATCAGCACTTTCTGGACATGAAGGTGATGTTATCCCGTGGC
AAAAGCTTCAAGTGTAAAGAGCCTGGCTGGTTCCACCTCATGTTTGCAGAAAAGCTTCCA
ACGCTGGAGGTGGCCATGCAACGGTTGCACAACGCG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PFQLK-KNWEQAMGEARFWGKRVKGLVLVNPQNPLGGIYSQESLKEYLEFAKRNYLHVIMDEIYMLTVFDDSLKFHSVLSIKSLPDPNRTHVIWGTSKDF
PFQL..K..EQAM.EAR..GKRVKGLVLVNPQNPLGGIYSQESLKEYLEFAKRNYLHVIMDEIYMLTVFDDSLKFHSVLSI.S.PDPNRTHVIWGTSKDF
Retrocopy
PFQLTVKKLEQAMVEARLKGKRVKGLVLVNPQNPLGGIYSQESLKEYLEFAKRNYLHVIMDEIYMLTVFDDSLKFHSVLSIESWPDPNRTHVIWGTSKDF


Parental protein
GISGFRFGALYTHNKDVASAVCSFGYLHSTSGTAQYKLHRLLQDTEWINTVYLPTNLSRLRKAYNYVTGQLKLLGIPFLSGGAGLYIWINLKSYLEPCTF
GISGFRFGALYTHNKDVASAVCSFGYLHSTSGTAQYKLHRLLQDTEWINTVYLPTNLS.LRKAYNYVTGQLKLLGIPFLSGGAGLYIWINLKSYLEPCTF
Retrocopy
GISGFRFGALYTHNKDVASAVCSFGYLHSTSGTAQYKLHRLLQDTEWINTVYLPTNLSQLRKAYNYVTGQLKLLGIPFLSGGAGLYIWINLKSYLEPCTF


Parental protein
DEELALHQHFLDMKVMLSRGKSFKCKEPGWFRLMFAEKLPTLEVAMQRLHNA
DEELALHQHFLDMKVMLSRGKSFKCKEPGWF.LMFAEKLPTLEVAMQRLHNA
Retrocopy
DEELALHQHFLDMKVMLSRGKSFKCKEPGWFHLMFAEKLPTLEVAMQRLHNA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide