RetrogeneDB ID:
retro_opri_812
Organism:
Location:
scaffold_33082:2-542 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
86.11 %
Coverage:
80.36 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
MOB4
Parental gene aliases:
No gene alias available
Parental gene description:
MOB family member 4, phocein [Source:HGNC Symbol;Acc:17261]

Genomic region (view in browser)





>retro_opri_812
ATGGTCATGGCGGAGGGGACGGCAGTGTTGAGGCGGAACAGGCCGGGCACCAAGGCGCAG
GATTTCTATAATTGGCCTGATGAATCCTTTGATGAGATGGACAGTACACTTGCTGTTCAG
CAGTATATTCAACAGAACATAAGAGCAGATTGCTCCAATATTGACAAAATTCTTGAACCA
CCTGAAGGCCAAGATGAAGGGGTGTGGAAGTATGAACATTTAAGGCAATTCTGTCTTGAA
CTAAATGGACTTGCTGTGAAGCTTCAGAGTGATTGCCATCCGGACACCTGTACTCAAATG
ACAGCAACCGAACAATGGATTTTTCTCTGTGCAGCTCATAAAACTCCCAAAGAGTGTCCT
GCTATAGACTACACTAGACACACGCTTGATGGTGCTGCATGTCTTCTGAATAGTAATAAA
TATTTTCCTAGCAGGGTTAGCATAAAGGAATCATCTGTAGCAAAACTAGGATCAGTATGC
CGTAGGATTTACAGAATATTTTCACATGCTTATTTTCATCACCGCCAGATATTTGATGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVMAEGTAVLRRNRPGTKAQXXXXXXXXXFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLXXXXXXXXXXXXXXXSECHPDTCTQM
MVMAEGTAVLRRNRPGTKAQ.........FDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHL...............S.CHPDTCTQM
Retrocopy
MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSDCHPDTCTQM


Parental protein
TATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDE
TATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDE
Retrocopy
TATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide