RetrogeneDB ID:
retro_opri_815
Organism:
Location:
scaffold_3379:169243-170590 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.7 %
Coverage:
67.32 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
KIF2A
Parental gene aliases:
No gene alias available
Parental gene description:
kinesin heavy chain member 2A [Source:HGNC Symbol;Acc:6318]

Genomic region (view in browser)





>retro_opri_815
CAGAAAAAGTCTCCCTGCTTACGGGAAATTGAGAAACTGCAGAAGCAGCGGGAGCAGCGT
CAGCAGCTCCATCTGGAAATCCGATCTAGGCGTGCCCTGGACATCAACAGGGGAAACCGC
AACCATGAGATCATGTGCATGATCGAGGAGTACCGCAGGCACCTGGATAAAAACGTGCTG
TGCAGCTGTGAGCCCCCAGAAGACCACCGAATCTGCGTCTGCGTGAGGAAGCGGCCCCTC
AACCAGCGTGAGACCACCATGAAAGACTTGGATATCATCACCATCCCCTCGGACAAAGTG
GTCATGGTGCACGAGTCCAAGCAAAAGGTGGACCTCACGCGCTACCTGGAGAACCAGATA
TTCTGCTTTGACCATGCCTTTGATGACACTGCCTCCAATGAACTAGTGTACCAGTTCACA
GCGCAGCCGCTGGTGGAGTCCATCTTTCGCAAGGGCATGGCCACCTGCTTTGCCTATGGG
CAGACAGGTAGTGGGAAAACACACACCATGGGAGGAGCTTTCTCTGGAAAGGCACAGAAC
TGTTCCAAAGGTATTTATGCCTTGGTCGCACAGGATGTCTTTCTCTTGCTCAAAAACCCG
ACTTATGAGAAGTTCGACCTTAAAGTCTACGGGACGTTCTTTGAGATTTACGGGGGCAAG
GTGTATGACCTGCTGAACTGGAAGAAGAAGCTGCAGGTCCTGGAGGACGGCCATCAGCAA
ATCCAAGTGGTGGGGCTGCAGGAGCGGGAGGTGTGCTGCGTGGAGGAAGTGTTGAGCCTG
GTGGAGCTGGGGAACAGCTGTCGGACTTCAGGGCAGACCTCAGTCAATGCCCAGTCCTCC
AGGAGCCACGCAGTGTTCCAGATCATCCTGAAGTCAAGAGGGAAACTGCATGGAAAGTTT
TCCCTGGTTGACTTGGCTGGGAATGAAAGGGGAGCAGACACAGCCAGGGCCAATCGGAAG
AGACAGCTGGAAGGGGCAGAGATTAATAAGAGCCTCCTAGCTCTCAAAGAGTGCATCAGG
GCTTTGGGGAAGAACAAGCCTCACACCCCATTCAGAGCCAGCAAACTCACACAGGTGCTC
AGGGACTCCTTCATAGGGCAGAACTCCTCCACCTGCATGATCGCCACCATCTCCCCAGGG
ATGACCTCCTGTGAGAACACCCTCAACACCCTGAGATACGCACATAGGGTGAAAGCGCTC
ACCTTGGATATGAGGTGTTGTCCTCGTAGCCTCTGTCCCGTGGGACACGAGGCTCCACAG
TTGTTGGAAAAACAGTCCAAGAATTCAGATATGTCCCTCCAGAGGCACGAATTTATGAAA
ACGCCTTGCATGCAGAACGACGAGGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPXXXXXXXXXXXXXXXXXXXTQMKDLDVITIPSKDV
..KS.C..E.EKLQ..RE.R.....E.R..RA.D....N.N.EIMCMI...R..LD...L....P...................T.MKDLD.ITIPS..V
Retrocopy
QKKSPCLREIEKLQKQREQRQQLHLEIRSRRALDINRGNRNHEIMCMIEEYRRHLDKNVLCSCEPPEDHRICVCVRKRPLNQRETTMKDLDIITIPSDKV


Parental protein
VMVHEPKQKVDLTRYLENQTFRFDYAFDDSAPNEMVYRFTARPLVETIFERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLMLKKP
VMVHE.KQKVDLTRYLENQ.F.FD.AFDD.A.NE.VY.FTA.PLVE.IF..GMATCFAYGQTGSGKTHTMGG.FSGK.Q.CSKGIYAL.A.DVFL.LK.P
Retrocopy
VMVHESKQKVDLTRYLENQIFCFDHAFDDTASNELVYQFTAQPLVESIFRKGMATCFAYGQTGSGKTHTMGGAFSGKAQNCSKGIYALVAQDVFLLLKNP


Parental protein
NYKKLELQVYATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIDIGNSCRTSGQTSANAHSSRSHAVFQIILRRKGKLHGKF
.Y.K..L.VY.TFFEIY.GKV.DLLN.K.KL.VLEDG.QQ.QVVGLQEREV.CVE.VL.L...GNSCRTSGQTS.NA.SSRSHAVFQIIL...GKLHGKF
Retrocopy
TYEKFDLKVYGTFFEIYGGKVYDLLNWKKKLQVLEDGHQQIQVVGLQEREVCCVEEVLSLVELGNSCRTSGQTSVNAQSSRSHAVFQIILKSRGKLHGKF


Parental protein
SLIDLAGNERGADTSSADRQTRLEGAEINKSLLALKECIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENTLNTLRYANRVKEL
SL.DLAGNERGADT..A.R...LEGAEINKSLLALKECIRALG.NKPHTPFRASKLTQVLRDSFIG.NS.TCMIATISPGM.SCENTLNTLRYA.RVK.L
Retrocopy
SLVDLAGNERGADTARANRKRQLEGAEINKSLLALKECIRALGKNKPHTPFRASKLTQVLRDSFIGQNSSTCMIATISPGMTSCENTLNTLRYAHRVKAL


Parental protein
TVDPTAAGDVRPVIHHPPSQIDDVEAQWGVGSSPQRDDLKLLCEQNEEE
T.D............H...Q...........S.......K..C.QN.E.
Retrocopy
TLDMRCCPRSLCPVGHEAPQLLEKQSKNSDMSLQRHEFMKTPCMQNDED


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide