RetrogeneDB ID:
retro_opri_824
Organism:
Location:
scaffold_34754:402-1271 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.47 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
YBX2
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 2 [Source:HGNC Symbol;Acc:17948]

Genomic region (view in browser)





>retro_opri_824
CCGGCGACGGCAGCCTCGGGGACCCCCGCGCCCCCGGCCCGGAGTCAGGCGGACAAGCCG
GTGCTGGCAATTCAGGTCCTGGGTACCGTCAAATGGTTCAACGTCCGGAATGGTTATGGA
TTCATCAACAGGAATGACACCAAGGAGGATGTCTTTGTTCACCAGACAGCTATCAAGAGA
AACAACCCCAGGAAGTTTCTGCGCAGCGTTGGAGACGGGGAGACGGTGGAGTTTGATGTC
GTGGAAGGAGAGAAGGGTGCTGAAGCTGCTAATGTAACTGGGCCTGGGGGTGTGCCAGTG
AAGGGCAGCCGCTATGCCCCCAATCGACGCCGGTTCCGTCGATTCATCCCCCGGCCTCGC
CCAGCTGCCCCACCACCCATGGTGGCAGAGGCGCCCACCAGTGGGGCAGAACCTGGCAGT
GAAGGGGAGCGGGCTGAAGACTCAGGGCAGCGGCCCCGGCGCCGGCGCCCGCCGCCTTTT
TCTACCGCCGGCGGTTTGTGCGAGGCCCACGGCCCCCCAACCAGCAGCAGTCCATAGAGG
CTATTGACGGGGTGGAGCCCAAAGACACAGCCCCACTGGAGGGAGACCAACAGCAGGGAG
ATGAGCGGGTCCCCCCACCAAGATTCCGGCCCAGGTATCGCAGGCCTTTCCGCCCAAGGC
CACCCCAGCAGCCAACCACAGAAGGTGGAGATGGTGAGACCAAGCCCAGCCAAGGCCCCA
CTGACGGCTCCCGGCCCGAGCCCCAGCGCCCACGAAACCGCCCCTACTTCCAGCGGCGCC
GGCAACAGCCCCCCGGCCCTCGGCAGCCCACAGTGCCAGAGACCTCAGCCCCCATCAACA
GTGGGGACACCCCCCCTACCATGCTGGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PATAASGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVSV
PATAASGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGV.V
Retrocopy
PATAASGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV


Parental protein
KGSRYALNRRSFRRFILRPRSAASSLMVTEASSVGQNLGSEGERAEDSGQR-LRRRPPPF-FYRRRFVRGPRPPNQQQSIEATDGVEPKDTAPLEGDQQQ
KGSRYA.NRR.FRRFI.RPR.AA...MV.EA...G...GSEGERAEDSGQR..RRRPPPF.FYRRRFVRGPRPPNQQQSIEA.DGVEPKDTAPLEGDQQQ
Retrocopy
KGSRYAPNRRRFRRFIPRPRPAAPPPMVAEAPTSGAEPGSEGERAEDSGQRPRRRRPPPF/FYRRRFVRGPRPPNQQQSIEAIDGVEPKDTAPLEGDQQQ


Parental protein
GDERVPPPRFRPRYRRPFRPRPPQQPTTEGGDGETKPSQGPTDGSRPEPQRPRNRPYFQRRRQQPPGPRQPTVPETSAPINSGDTPPTMLE
GDERVPPPRFRPRYRRPFRPRPPQQPTTEGGDGETKPSQGPTDGSRPEPQRPRNRPYFQRRRQQPPGPRQPTVPETSAPINSGDTPPTMLE
Retrocopy
GDERVPPPRFRPRYRRPFRPRPPQQPTTEGGDGETKPSQGPTDGSRPEPQRPRNRPYFQRRRQQPPGPRQPTVPETSAPINSGDTPPTMLE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide