RetrogeneDB ID:
retro_opri_827
Organism:
Location:
scaffold_3486:117314-118925 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.77 %
Coverage:
72.59 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PAPOLG
Parental gene aliases:
No gene alias available
Parental gene description:
poly(A) polymerase gamma [Source:HGNC Symbol;Acc:14982]

Genomic region (view in browser)





>retro_opri_827
AAGCGCTACGGCATCTCCTCGCCCATCAGCCTGGCCACCCCCAAGGAGACGGACTGCGCG
CTCACCCAGAAGCTCATCGAGACCCTGCGGCCCTTCGGCGTGTTCGAGGAGGAGGAGGAG
CTGCAGGGCCGGAGCCTGATCCTGGAGAAGTTGAACAAGTTGGTGAAGGAGTGGATCCGC
GAAGTCAGTGCGAGCAAGAGCCTGCCCGAGGTGCTGGTGGAGAGCGTGGGCGGCCGGCTC
TTCACCTTCGGCTCCTACCGCCTGGGCGTGCACACCAAGGGCGCCGACATCGACGCGCTG
TGCGTGGCGCCCAGGCACGTGGACCGCAGCGACTTCTTCACCTCCTTCTACGACAAGCTG
AAGCTGCAGGAGGAGGTGAAGGACCTGCGGGCCGTGGAGGAGGCGTTCGTGCCGGTCATA
AAGCTGTGTTTTGATGGGGTAGAGATCGACATTTTGTTTGCAAGGTTGGCGCTGCAGACC
ATTCCAGAAGACTTGGATTTGAGGGATGACAGTTTGCTCAAGAACTTAGATATCAGATGC
ATCAGGAGTCTTAACGGTTGCCGGGTAACCGATGAGATATTACACCTGGTCCCAGACATG
GACAACTTCAGGTTAACGCTGAGAGCTATCAAGCTGTGGGCCAAGTGCCACAATATCTAC
TCCAACATACTCGGCTTCCTGGGCGGCGTTTCCTGGGCCATGCTGGTGGCGAGAACCTGC
CAGCTCTACCCGAATGCGGTAGCCTCCACTCTGGTGCGTAAATTTTTCTTGGTGTTTTCG
GAATGGGAGTGGCCCAACCCGGTGCTGCTCAAAGAGCCGGAGGAGCGGAACCTGAACCTG
CCGGTCTGGGACCCGAGAGTGAACCCCAGTGACCGCTACCACCTGATGCCGATCATCACC
CCGGCATACCCGCAGCAGAACTCCACCTACAACGTGTCCGTCTCCACCAGGAGGGTCATG
GTGGAGGAGTTTAAACAAGGCCTCGCCATCACACACGAGATCCTGCTCAACAAGGCAGAG
TGGTCTAAACTTTTTGAAGCTCCAAGCTTCTTCCAGAAGTACAAGCACTACATCGTTCTT
ATAGCAAGTGCGCCGACGGAGAAGCAGCATCTGGAGTGGGTCGGCCTGGTGGAGTCCAAG
ATCCGGATCCTAGTCGGGAGCCTGGAGAAGAATGAGTTCATCACCCTGGCGCACGTGAAC
CCCCAGTCGTACCCGGCACCCAAAGAGAAGCCCAAGCAGGAGGAGTTCTGCACCATGTGG
GTGATCGGGCTGGTGCTGAAGAGGCCCGAGAACTCCGAGGTGCTCAGCGTGGACCTCACC
TACGACATCCAGTCGTTCACTGACACCGTGTATCGGCAGGCCATCAACAGCAAGATGTTT
GAGATGGATATGAAAGTTGCTGCCATGCATTTGAGAAAGAAAGAGCTCCAGGAGCTGCTC
CCGAACCACGTATTTCAGAAAAAGAAGACCCACCCGGCAGAGGGCGTCACCCTGACAGCC
ACGAGTGATGATGGCAGTGTCGGGACAGACAGCGAAGACAGCGTGTCCACACCCTTGCCC
CCTGGCCTCTTGACTGGCAGCTCCCAGGACACCAGCAGCCCCGCCCCACCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KHYGITSPISLACPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDISESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDAL
K.YGI.SPISLA.PKE.D...TQKLI....PFGVFE.EEEL..R...L.KLN.LVKEWI...S.SK.LP...V..VGG..FTFGSYRLGVHTKGADIDAL
Retrocopy
KRYGISSPISLATPKETDCALTQKLIETLRPFGVFEEEEELQGRSLILEKLNKLVKEWIREVSASKSLPEVLVESVGGRLFTFGSYRLGVHTKGADIDAL


Parental protein
CVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNK
CVAPRHV.RSDFF.SF..KLK.Q.....LRAVE.AFVPVIK..FDG.EID..FARLA.QTI...LDLRDDS.L..LDIRCIRSLNGCRVTDEILHLVP..
Retrocopy
CVAPRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGVEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPDM


Parental protein
ETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPIIT
..FRLTLRA.KLWAK...IYSN.LGFLGGVSWAMLVARTCQLYPNA.ASTLV.KFFLVFS.WEWPNPVLLK.PEE.NLNLPVWDPRVNPSDRYHLMPIIT
Retrocopy
DNFRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAVASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIIT


Parental protein
PAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEEHHLEWVGLVESKIRVLVGNLERNEFITLAHVN
PAYPQQNSTYNVS.STR.VMVEEFKQGLA.T.EIL..K..WSKL.E.P.FFQKY.HYIVL.ASA.TE..HLEWVGLVESKIR.LVG.LE.NEFITLAHVN
Retrocopy
PAYPQQNSTYNVSVSTRRVMVEEFKQGLAITHEILLNKAEWSKLFEAPSFFQKYKHYIVLIASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVN


Parental protein
PQSFPGNKEHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQA-NNIMLKEGMK-EATHVKKKQLHHYLPAEILQKKKKQSLSDVSRSG
PQS.P..KE..K......MW..G....R.EN.E....DLTYDIQSFTDTVYRQA.N..M....MK..A.H..KK.L...LP....QKKK......V....
Retrocopy
PQSYPAPKEKPKQEEFCTMWVIGLVLKRPENSEVLSVDLTYDIQSFTDTVYRQAINSKMFEMDMKVAAMHLRKKELQELLPNHVFQKKKTHPAEGVTLTA


Parental protein
LQSKRSSLDSNCLDS-SRDTDNGTPFNSPVSTDKPSKP
..S...S......DS.S.....G....S...T..P..P
Retrocopy
-TSDDGSVGTDSEDSVSTPLPPGLLTGSSQDTSSPAPP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide