RetrogeneDB ID:
retro_opri_840
Organism:
Location:
scaffold_3634:52142-52487 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.93 %
Coverage:
78.38 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
FABP7
Parental gene aliases:
No gene alias available
Parental gene description:
fatty acid binding protein 7, brain [Source:HGNC Symbol;Acc:3562]

Genomic region (view in browser)





>retro_opri_840
ATGGTGGACGCCTTCCTGGCCACCTGGAAACTAGTAGAAAGCAAGAATTTCGATGACTAC
ATGAAGTCACTCGGTGTGGGTTTTGCTACCAGGCAAGTGCCCAATACGACCAAGTCCACC
ACAATCGAGAAGAAAGGCAACGCTATTGTCCTAAAAACACAGAGCATCTTCAAGAACACA
GACATCCGCTTCAAGCTGGGGGTGGAGTTCGATGAGACCACAGCAAATGACAGGATGGTT
AAGTCCATTGTGACACTGGATGGTGACAAGCTTGTCCATGTGCAGAAGTGGGATGGACAG
GAGACGACATTAGTGCGGGAACTAAGTGACGGCAAACTCTTCCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVEAFCATWKLVDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTQSTFKNTEISFRLGQEFDELSVDDRNCKSVISLNGDKLVHVQKWDG
MV.AF.ATWKLV.S.NFD.YMK.LGVGFATRQV.N.TK.T.I....G...V..TQS.FKNT.I.F.LG.EFDE....DR..KS...L.GDKLVHVQKWDG
Retrocopy
MVDAFLATWKLVESKNFDDYMKSLGVGFATRQVPNTTKSTTI-EKKGNAIVLKTQSIFKNTDIRFKLGVEFDETTANDRMVKSIVTLDGDKLVHVQKWDG


Parental protein
KQTVFVREIKDGKMIV
..T..VRE..DGK...
Retrocopy
QETTLVRELSDGKLFL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide