RetrogeneDB ID:
retro_opri_852
Organism:
Location:
scaffold_37039:35805-36588 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.34 %
Coverage:
64.29 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ERP44
Parental gene aliases:
No gene alias available
Parental gene description:
endoplasmic reticulum protein 44 [Source:HGNC Symbol;Acc:18311]

Genomic region (view in browser)





>retro_opri_852
ATGAATCCCGCCGTCTTCCTATCCTTATCCGACCTCAGATGCTCCGTGCTGCTCCTGGTA
ACTTGGGCTTTTACTCCAGTAACAACTGAAATCACAAGTCTTAATACAGAGAATATAGAT
GAAATTCTAAATAATGCTGATGTTGCTTTAGTAAATTTTTATGCTGACTGGTGCCGTTTC
AGCCAAATGTTACATCCAATTTTTGAGGAAGCTTCCGATGTCATTAAGGAAGAATATCCA
AGTCAGAATCAAGTGGTGTTTGCCAGAGTTGATTGTGATCAGCACTCTGATATAGCCCAG
AAATACAGAATAAGCAAATACCCGACTCTCAAGTTGTTCCGTAATGGAATGATGATGAAG
AGAGAATACCGAGGACAGCGATCCGTGAAAGCACTTGCAGATTACATCAGACAGCAAAAA
AGTGACCCAGTTCAAGAAGTTCAGAACTTAGCAGAAATCACCTCTATTGATCGCAGCAAA
AGAAATATCATTGGATATTTTGAGCAAAAGGATTCAGACAACTATAGAGTATTTGAAAGA
GTAGCAAGTATTTTGCATGATGACTGTGCCTTCCTTTCTGCATTTGGGGATGTTTCAAAG
CCAGAAAGATATAGTGGAGACAACATAATCTACAAACCACCAGGGCATTCAGCTCCAGAT
ATGGTGTATTTGGGATCTATGACAAATTTTGACGTGACTTACAATTGGATTCAAGATAAA
TGTGTTCCTCTTGTCCGAGAAATAACTTTTGAAAATGGAGAGGAATTGACAGAAGAAGGA
CTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNPAVFLSLSDLRCSVLLLVTWAFTPVTTEITSLNTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEYPSQNQVVFARVDCDQHSDIAQ
MNPAVFLSLSDLRCSVLLLVTWAFTPVTTEITSLNTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEYPSQNQVVFARVDCDQHSDIAQ
Retrocopy
MNPAVFLSLSDLRCSVLLLVTWAFTPVTTEITSLNTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEYPSQNQVVFARVDCDQHSDIAQ


Parental protein
RYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPVQEVQNLAEITSIDRSKRNIIGYFEQKDSDNYRVFERVASILHDDCAFLSAFGXXXX
.YRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPVQEVQNLAEITSIDRSKRNIIGYFEQKDSDNYRVFERVASILHDDCAFLSAFG....
Retrocopy
KYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPVQEVQNLAEITSIDRSKRNIIGYFEQKDSDNYRVFERVASILHDDCAFLSAFGDVSK


Parental protein
XXXXXXXXXXXXXXXHSAPDMVYLGSMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGL
...............HSAPDMVYLGSMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGL
Retrocopy
PERYSGDNIIYKPPGHSAPDMVYLGSMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide