RetrogeneDB ID:
retro_opri_880
Organism:
Location:
scaffold_4029:178316-178535 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.64 %
Coverage:
97.33 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
BET1
Parental gene aliases:
No gene alias available
Parental gene description:
Bet1 golgi vesicular membrane trafficking protein [Source:HGNC Symbol;Acc:14562]

Genomic region (view in browser)





>retro_opri_880
ACGTGCAGGCTGGGTGAAGGAGTCCCTCCTGGCAACTACGGCTACACTGGCAGCGGGTAT
AGCGCCTGTGAGGAAGATAAAGAGAGACTCAGCGAAAGTCTGAGGAGCAAAGTCAGTGCT
ATCAAATCTCTGTCCGTTGAAATGGACCATGAAGTTAAACATCAAAATAAATTACTAGCT
GAAATGGATTCACAGTTTGACTCTACAACAGGGATTCTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TVVLSDGVPPGNYGYAGSGYSACEEENERLTESLRSKVSAIKSXXXXXXXXXXXXXXXXXXXDSQFDSTTGFL
T..L..GVPPGNYGY.GSGYSACEE..ERL.ESLRSKVSAIKS...................DSQFDSTTG.L
Retrocopy
TCRLGEGVPPGNYGYTGSGYSACEEDKERLSESLRSKVSAIKSLSVEMDHEVKHQNKLLAEMDSQFDSTTGIL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide