RetrogeneDB ID:
retro_opri_896
Organism:
Location:
scaffold_4201:95979-96399 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.47 %
Coverage:
53.16 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_opri_896
GTGCTGGTCACAGTGAAATGGTTCAACGTCAAGAACCGATACGAATTCATCACCAGAAAA
GATACCCAGGATGACATCTTTGTCCACCAATCAGCAATCAAGAAGAACAACCCCTGCAAG
TACCTGCCCAGCCTGGGGGATGGTGAGACCATGGAGTTTGACGTGATAGAGGGTGAGAAG
GGCGTGGAAGCGGCCAAAGTCACCGACCCCGGGGGAGCCGCAGTCCAGAGCAGCAAGTAT
GTGCCCAAACGCACCCGATCCCGGCGCTACCCACGCCGGAGGGCTCCTAGGCCCCACTAC
CCACACGATTGCCTTGCCACTGACAGCGGTAGCTCAGATGCAACATCTGACGGCCAGGCC
TGTCCTCGCTGGCGCCGAGGCAGGCGCCGAAGGCTCCCATGCTGCTACCAGCCTCCACCG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VLGTVKWFNVRNGYGFINRXXXXXXXXXXXTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNY
VL.TVKWFNV.N.Y.FI.R............AIKKNNP.KYL.S.GDGET.EFDV.EGEKG.EAA.VT.PGG..VQ.SKY...R...RRYPRRR.P...Y
Retrocopy
VLVTVKWFNVKNRYEFITRKDTQDDIFVHQSAIKKNNPCKYLPSLGDGETMEFDVIEGEKGVEAAKVTDPGGAAVQSSKYVPKRTRSRRYPRRRAPRPHY


Parental protein
QQNYQNSESGEKNEGSESAPEGQAQQR-RPYRRRRFPPYYMRRP
........SG.....S.....GQA..R.R..RRRR.P..Y...P
Retrocopy
PHDCLATDSG----SSDATSDGQACPRWRRGRRRRLPCCYQPPP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide