RetrogeneDB ID:
retro_opri_907
Organism:
Location:
scaffold_43383:6631-6898 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.51 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL34
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L34 [Source:HGNC Symbol;Acc:10340]

Genomic region (view in browser)





>retro_opri_907
ATGGTGCAGCGCCTGACCTCCCGCCGTAGGCTTTCCTACAATACAGCCTCCAACAAAACC
AGACTGTCCCGAACTCCTGGGAACATAATGGTCTACCTTTACACCAAGAAGGTTGGGAAG
GCCCCGAAATCTGCATGTGGCGTGTGCCTGGGCCGACTGCGAGGGGTTCGGGCTGTGAGG
CCAAAAGTTCTGATGAGGTTGTCTAAGACAAAGAAACATGTCAGCAGGGCCTATGGTGGC
TCCATGTGCGCTAAATGTGTCCGTGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRD
MVQRLT.RRRLSYNTASNKTRLSRTPGN..VYLYTKKVGKAPKSACGVC.GRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRD
Retrocopy
MVQRLTSRRRLSYNTASNKTRLSRTPGNIMVYLYTKKVGKAPKSACGVCLGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide