RetrogeneDB ID:
retro_opri_930
Organism:
Location:
scaffold_4673:39810-40704 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.54 %
Coverage:
94.38 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TRA2B
Parental gene aliases:
No gene alias available
Parental gene description:
transformer 2 beta homolog (Drosophila) [Source:HGNC Symbol;Acc:10781]

Genomic region (view in browser)





>retro_opri_930
CAGCTTCGACGGAGGGCCAGCGAGCGGCGACAGCAGCCAGGCGTCATGAGCGACAGCGGC
GAGCAGAACTACGGCGAGCAGGGATCCCGCTCTGCTTCCCGAAGTGGAAGTGCTCACAGA
TCGGGGAATTCTGCAAGGCATAGCCCTGCAAGGTCTCACTCCAAGGAAGATTCCAGGCGT
TCCAGATCCAAGTCCAGGTCCAGATCCGAATCTAGGTCTAGATCCAGAAGAAGCTCGCGG
AAGCGTTACACGAGGTCGCGGTCCCGGTCCCGGTCCCATAGACGATCCCGTAGCAGGTCA
TACAGTCGCGATTATCGCAGACGGCATAGCCACAGCCATTCTCCCATGTCCACTCGTAGG
CGCCACGTTGGGAACCAGGCAAACCCTGACCCCAACCGCTGTCTTGGAGTATTTGGTTTG
AGCTTGTACACCACAGAGAGAGATCTCAGAGAAGTGTTTTCTAAGTACGGGCCCATTGCC
GACGTGGCTGTCGTGTATGACCAGCAGTCGCGGCGCTCCCGAGGATTTGCCTTTGTTTAT
TTTGAGAGCGTAGATGATGCCAAGGAAGCTAAGGAGCGCACCAATGGGATGGAGCTGGAT
GGGCGCAGGATCAGAGTTGATTTCTCTATAACAAAAAGACCACATACTCCAACACCAGGA
ATTTACATGGGGAGGCCCACGTATGGCAGTTCACGCCGTCGGGATTATTACGACCGAGGG
TATGACCGAGGCTATGACGACCGAGACTACTATAGCAGGCCGTATAGAGGGGGTGGCTGG
AGAGCCGCCCAGGAGAGAGAGGAGATCTATAGAAGACGCTCGCCTTCACCCTACTATAGT
CGTGGCGGATACAGATCGCGCTCCAGGTCGCGCTCCTACTCCCCCCGCCGCTAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QLRRKRGGR-QQPGVMSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTRSRSRSRSHRRSRSRS
QLRR....R.QQPGVMSDSGEQNYGE..SRSASRSGSAH.SG.SARH.PARS.SKEDSRR................RSSR..YT.........RRSRSRS
Retrocopy
QLRRRASERRQQPGVMSDSGEQNYGEQGSRSASRSGSAHRSGNSARHSPARSHSKEDSRRXXXXXXXXXXXXXXXXRSSRKRYTXXXXXXXXXRRSRSRS


Parental protein
YSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELD
YSRDYRRRHSHSHSPMSTRRRHVGN.ANPDPN.CLGVFGLSLYTTERDLREVFSKYGPIADV..VYDQQSRRSRGFAFVYFE.VDDAKEAKER.NGMELD
Retrocopy
YSRDYRRRHSHSHSPMSTRRRHVGNQANPDPNRCLGVFGLSLYTTERDLREVFSKYGPIADVAVVYDQQSRRSRGFAFVYFESVDDAKEAKERTNGMELD


Parental protein
GRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSP
GRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDY....YDRGYD.R.Y..R.Y......GGGWRAAQ.R..IYRRRSPSPYYSRGGYRSRSRSRSYSP
Retrocopy
GRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDY----YDRGYD-RGYDDRDYYSRPYRGGGWRAAQEREEIYRRRSPSPYYSRGGYRSRSRSRSYSP


Parental protein
RRY
RRY
Retrocopy
RRY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide