RetrogeneDB ID:
retro_opri_949
Organism:
Location:
scaffold_489:221188-222100 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
98.36 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
DTWD1
Parental gene aliases:
No gene alias available
Parental gene description:
DTW domain containing 1 [Source:HGNC Symbol;Acc:30926]

Genomic region (view in browser)





>retro_opri_949
ATGTCTCTCAACTCACCTATATTTCTCGAAGAAAGTGAAGAAAGTAATTCAAAATTTGTG
GAAACAAAACAGTCACAGACTACTTCCATAGCTTCAGAAGATCCCCTTCAGAACTTATGT
TTAGCATCTCAAGAAGTTCTTCATAAAGCTCAACAAACTGGGAGATCAAAGTGTCTACGA
TGTGGTGGTTCCAGAATGTTTTACTGCTATACATGTTATGTCCCAGTTGAAAATGTACCT
ATTGAACAGATTCCACTTGTGAAGCTTCCATTGAAGATCGACATCATTAAACATCCAAAT
GAAACAGATGGCAAAAGTACTGCTATACATGCAAAACTCTTAGCACCTGATTTTGTGAAC
ATTTATACATATCCTTGTATTCCAGAATATGAAGAACAGGATTATGAAGTTGCGCTTATT
TTTCCTGGACCTCAGTCTGTCTCCATAAAAGATATCTCTTTCCATCTACAAAAACGAATG
CAAGATAATATTAGAGACAAAAGTGATGACCCTGATAAGCCAACTGTTAAACGTAAAAAA
ACTGAAGAAATGGAGGACCTTGATTTGATTGGCAGCAAGGGCAAAGGCACAATACTGAAA
AAAATTATTTTTATAGATAGCACTTGGAACCAGACAAACAAAATATTCACTGATGAGAGA
CTTCAAGGATTGTTACAAGTTGAGTTGAAAACAAGAAAAACTTGCTTTTGGCGCCATCAA
AAAGGAAAGCCAGACACTTTCCTTTCCACAATTGAAGCAATTTACTACTTTCTTGTGGAC
TACCATACTGAAATACTAAAAGAGAAATACACAGGACAATATGACAATCTTTTATTTTTC
TACTCCTTTATGTACAGGCTGATAAAGGATGCCAAATGCTCTGGAGATAAAGAAAAAAGA
AAACTTATCCAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSLNSPVFLEESEESNSKFVETKQSQTTSIASEDPLQNLCLASQEVLYKAQQTGRSKCLRCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPN
MSLNSP.FLEESEESNSKFVETKQSQTTSIASEDPLQNLCLASQEVL.KAQQTGRSKCLRCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPN
Retrocopy
MSLNSPIFLEESEESNSKFVETKQSQTTSIASEDPLQNLCLASQEVLHKAQQTGRSKCLRCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPN


Parental protein
ETDGKSTAIHAKLLAPDFVNIYTYPCIPEYEEQDHEVALIFPGPQSVSIKDISFHLQKRMQDNIRDKSDDPDKPTVKRKKTEEMEGLDLIGSKGKGTILK
ETDGKSTAIHAKLLAPDFVNIYTYPCIPEYEEQD.EVALIFPGPQSVSIKDISFHLQKRMQDNIRDKSDDPDKPTVKRKKTEEME.LDLIGSKGKGTILK
Retrocopy
ETDGKSTAIHAKLLAPDFVNIYTYPCIPEYEEQDYEVALIFPGPQSVSIKDISFHLQKRMQDNIRDKSDDPDKPTVKRKKTEEMEDLDLIGSKGKGTILK


Parental protein
KIIFIDSTWDQTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTEILKEKYTGQYDNLLFFYSFMYRLIKDAKCSGDKEKR
KIIFIDSTW.QTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTEILKEKYTGQYDNLLFFYSFMYRLIKDAKCSGDKEKR
Retrocopy
KIIFIDSTWNQTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTEILKEKYTGQYDNLLFFYSFMYRLIKDAKCSGDKEKR


Parental protein
KLIH
KLIH
Retrocopy
KLIH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide