RetrogeneDB ID:
retro_opri_979
Organism:
Location:
scaffold_5212:123577-125299 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
91.13 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RNGTT
Parental gene aliases:
No gene alias available
Parental gene description:
RNA guanylyltransferase and 5'-phosphatase [Source:HGNC Symbol;Acc:10073]

Genomic region (view in browser)





>retro_opri_979
AGATTCTTGCCTCTCAAGACAATGTTAGGACCAAGATACGATAGTCAAGTTGCTGAAGAA
AATCGATTCCATCCCACCATGCTCTCCAATTATCTCAAGAGTCGAAAGGTGAAAATGAGC
TTATTGGTAGACTTGACCAACACTTCAAGATTCTATGATAGGAGTGACATAGAAAAAGAA
GGAATTACGTATGTAAAGCTTCCGTGTAAAGGACATGGTGAGTGCCCGACAACCGAGGTC
ACCAATACATTTATTCGTCTGTGTGAGCAGTTTCACGACAGAACGCCACCCGAACTGATC
GGTGTTCATTGTACCCATGGTTTCAATCGTACTGGCTTCCTCATTTGTGCCTTTTTGGTG
GAGAACATGGATTGGAGCATTGAAGCAGCAGTTGCTACTTTTGCCCAAGCCAGACCACCA
GGAATCTATAAGGGCGATTATTTGAAGGAACTCTTTTGGCGCTATGGCGCTAGAGAAGCA
CCAACCCCACCTCTCTTGCCAGCTTGGTGTTTGGAAGATGAGGAAGATGAAGGGGAGGAA
GAGGATGGGAACAAGAAATCAGAGCCCGGATCAAGTGCTTCCTTTGGCAAAAGGAGGAAA
GAAAGGTTGAAAGTGGGTGCCATTTTCTTGGAAGGTATAACTGTGAACGGTGTGACTCAA
GTAACAACTCAACCAAAGCTAGGAGAGGTACAACAGAAGTGTCATCAATTTTGTGGCTGG
GAAGGGTCTGGATTCCCTGGAGCACAGCCCGTTTCCATGGACAAGCAAAATATTACACTT
TTAGAGCAGAAGCCATATAAAGTAAGCTGGAAAGCAGATGGCACTCGTTACATGATGTTG
GTTGATGGCACAAATGAAGTCTTTATGATTGATCGAGATAATTCAGTGTTTCATGTTTCT
AATCTGGAATTTCCATGTCGGAAAGACCTTCAAATCCATTTATCGAATACTCTTTTGGAT
GGCGAGATGATTATTGACAGAGTAAACGGACAGGCTCTTCCTAGATATTTGATATATGAC
ATCATTAAATTCAATGCACAGCCAGTTGGAGATTGCGACTTGAATGTCCGCTTGCAGTGT
ATAGAACGAGAAATTATAAATCCTCGGCACGAGAAAATGAAGACCGGACTCATTGACAAG
ACACGGGAACCATTTAGTGTCAGAAAGAAGCCGTTTTTTGACATTCATACTTCAAGAAAG
CTGCTTGAAGGAAATTTTGCCAAACAAGTCAGTCATGCAGTGGATGGACTTATATTTCAG
CCCATCGGGAAGTATAAGCCTGGTCGGTGTGATGATATTTTGAAGTGGAAACCTCCCAGT
TTGAATTCTGTGGATTTCCGCCTGAAGATAACAAGACTGGGAGGAGAAGGGCTACTTCCT
CAGAATGCCGGTCTTCTCTATGTTGGAGGCTACAAAAGACCCTTTGCCCAAATCAAGGTG
ACAAAAGAGCTCAATCAGTATGACAACAAAATCATAGAATGCAGATTTGAGAAGAACAGC
TGGGTCTTCATGAGACAGAGAACAGACAAAAGTTTTCCGAATGCCTATAACACTGCCATG
GCTGTGTGCAATAGCATCTCAAACCCTGTCACCAAGGAGATGCTGTTTGAGTTCATCGAC
AGATGTGCTGCAGCTTTTCAAGGACAGAAGCAAAAGCATCATCTGAACCCTGACACACAG
CTCATGCCCCCGCCGCCTCCCAAAAGACCACGCCCTGCCACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKXXXXXXVDLTNTSRSYDRNDIEKEGITYIKLQCKGHGECPTTEVTNTFIRLCERFNDRTPPELI
RFLPLKTMLGPRYDSQVAEENRFHP.MLSNYLKS.K......VDLTNTSR.YDR.DIEKEGITY.KL.CKGHGECPTTEVTNTFIRLCE.F.DRTPPELI
Retrocopy
RFLPLKTMLGPRYDSQVAEENRFHPTMLSNYLKSRKVKMSLLVDLTNTSRFYDRSDIEKEGITYVKLPCKGHGECPTTEVTNTFIRLCEQFHDRTPPELI


Parental protein
GVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDEDEEEDGKKESEPGSSASFGKRR
GVHCTHGFNRTGFLICAFLVE.MDWSIEAAVATFAQARPPGIYKGDYLKELF.RYG...EAP.PPLLP.WC.ED.EDE.EEEDG.K.SEPGSSASFGKRR
Retrocopy
GVHCTHGFNRTGFLICAFLVENMDWSIEAAVATFAQARPPGIYKGDYLKELFWRYG-AREAPTPPLLPAWCLEDEEDEGEEEDGNKKSEPGSSASFGKRR


Parental protein
KERLKLGAIFLEGITVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLEQKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHV
KERLK.GAIFLEGITV.GVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNI.LLEQKPYKVSWKADGTRYMML.DGTNEVFMIDRDNSVFHV
Retrocopy
KERLKVGAIFLEGITVNGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNITLLEQKPYKVSWKADGTRYMMLVDGTNEVFMIDRDNSVFHV


Parental protein
SNLEFPFRKDLRIHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNAQPVGDCDFNIRLQCIEREIINPRHEKMKTGLIDKTQEPFGVRNKPFFDIHTSR
SNLEFP.RKDL.IHLSNTLLDGEMIIDRVNGQA.PRYLIYDIIKFNAQPVGDCD.N.RLQCIEREIINPRHEKMKTGLIDKT.EPF.VR.KPFFDIHTSR
Retrocopy
SNLEFPCRKDLQIHLSNTLLDGEMIIDRVNGQALPRYLIYDIIKFNAQPVGDCDLNVRLQCIEREIINPRHEKMKTGLIDKTREPFSVRKKPFFDIHTSR


Parental protein
KLLEGNFAKAVSHEMDGLIFQPIGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENN
KLLEGNFAK.VSH..DGLIFQPIGKYKPGRCDDILKWKPPSLNSVDFRLKITR.GGEGLLPQN.GLLYVGGY.RPFAQIKVTKEL.QYDNKIIEC.FE.N
Retrocopy
KLLEGNFAKQVSHAVDGLIFQPIGKYKPGRCDDILKWKPPSLNSVDFRLKITRLGGEGLLPQNAGLLYVGGYKRPFAQIKVTKELNQYDNKIIECRFEKN


Parental protein
SWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCAAAFQGQKRKHHLDPDAELMPPPPPKRPRPAT
SWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCAAAFQGQK.KHHL.PD..LMPPPPPKRPRPAT
Retrocopy
SWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCAAAFQGQKQKHHLNPDTQLMPPPPPKRPRPAT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide