RetrogeneDB ID:
retro_opri_992
Organism:
Location:
scaffold_535:320170-320392 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.33 %
Coverage:
71.43 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
NDUFB1
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa [Source:HGNC Symbol;Acc:7695]

Genomic region (view in browser)





>retro_opri_992
CTAGCTGCCCTTGGTTGTGGGGTCGCTGTTGGCACCAGGACCGGAGTCATGGCAAACTTA
CTTCACTTGGTGCGCGACCACTGGGTGCATCTGCTTGTCCCTGTGGGCTTTGTCTTCGGA
TGCTACCTGGACAGGAGGAGCGATGAAAAGCTCACAGCTTTCCAAAACAAGAGCATGCTG
TTTAAAAGGGAGTTGAGGCCTAATGAAGAAGTTACCTGGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LAALGGGVAVGTRAGAVMASLLHLVRDHWVHLLVPVGFVFGCYLDRRSDEKLTAFRNKSMLFKRELRPNEEVTWK
LAALG.GVAVGTR.G.VMA.LLHLVRDHWVHLLVPVGFVFGCYLDRRSDEKLTAF.NKSMLFKRELRPNEEVTWK
Retrocopy
LAALGCGVAVGTRTG-VMANLLHLVRDHWVHLLVPVGFVFGCYLDRRSDEKLTAFQNKSMLFKRELRPNEEVTWK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide