RetrogeneDB ID:
retro_opri_997
Organism:
Location:
scaffold_5391:71007-71358 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.39 %
Coverage:
87.94 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
MRPL42
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein L42 [Source:HGNC Symbol;Acc:14493]

Genomic region (view in browser)





>retro_opri_997
CAACGGGTGATATCAAACACAACTATCTGGAAACATTTATCTCCAACCCATGGAGCTTTA
TATTGTGTTTGCCATAAATCTACATATTCTCCTCTTCCAGATGACTATAACTGTAAAGTA
GAACTTGCTTTGACATCAGATGGCAGAACCATAGTTATCACCCTTCCATGGATATTCCAT
GAACATACCAAACCTATCCCTCGACCAGATCCTGTGCTTAATAATGAAGAAACACACGAT
CAAGTGCTAAAAACCAGACTGCAAGGAAAAAGTGAACACCTTGAGCAGGGACCCATGTTG
GAACAACTTTACTACGAACACCACTGGTATCCTCATGGACATTATTACAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KRVISNTAVWRHFSPTHELLYCVCRKSTYSSLPEDYKCKVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVLNNEETHDQVLKTRLQGKSEHLEQGP
.RVISNT..W.H.SPTH..LYCVC.KSTYS.LP.DY.CKVELALTSDGRTIV...P......EHTKPIPRPDPVLNNEETHDQVLKTRLQGKSEHLEQGP
Retrocopy
QRVISNTTIWKHLSPTHGALYCVCHKSTYSPLPDDYNCKVELALTSDGRTIVITLPWIF--HEHTKPIPRPDPVLNNEETHDQVLKTRLQGKSEHLEQGP


Parental protein
MVEQLSKMFFTTKHRWYPHGHYHR
M...L........H.WYPHGHY.R
Retrocopy
M---LEQLYY--EHHWYPHGHYYR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide