RetrogeneDB ID:
retro_sscr_983
Organism:
Pig ( Sus_scrofa )
Location:
8:120250588-120251329 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.57 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
40S ribosomal protein S6 [Source:UniProtKB/TrEMBL;Acc:F2Z5Q6]

Genomic region (view in browser)





>retro_sscr_983
CTGAATATCTCTTTCCCGGCCACTGGCTGCCAAAAACTCATTGAAGTGGACAATGAGCGA
AAACTTCGTACATTTTATGAGAAATACATGGCCACAGAAGTTTCTGCTGACGCTCTGGGT
GAAGAATGGAAGGGTAATGTGGTCCGAATAAGTGGTGGGAACGACAAACAAGGATTTCCC
ATGAAGCAGGGTGTCTTGACCCATGGCCGAGTCCGCCTGCTACTGAGTAAGGGGCATTCC
TGTTACAGACCAAGGAGGACTGGAGAAAGAAAGCGCAAATCAGTTCGGGGTTGCATTGTG
GATGCCAATCTAAATGTTCTCAATTTGGTCATCGCAAAAAAAAGGGGAGAAGGATATTCC
TGGACTCACCGATACTACTGTGCCTCGCTGCCTGGGGCCTAAAAGAGCTAGCAGAATCCG
AAAAATTTCAGTCTCTCTAAGGAAGATGATGTCCGTCAGTATGTAGTGAGAAAGCCCCTA
AACAAAGAAGGTAAGAAACCTAGGACCAAAGCACCCAAGATTCAGCGTCTTGTTACTCCG
CGTGTTCTGCAACACAAACGTCGCCATATTGCTCTGAAGAAACAACGTACTAAGAAAAAT
AAGGAAGAGGCTGCAGAATATGCTAAACTTTTGGCCAAGAGAATGAAGGAGGCCAAAGAA
AAATGTCAGGACCAGATTGCAAAGAGACGGAGGCTATCCTCTCTGAGAGCATCTACCTCT
AAGTCTGAGTCCAGTCAAAAA

Library Expression (reads per million mapped reads)
SRP014902_placenta 0.25
SRP014902_testis 1.42
SRP018288_heart 4.0
SRP018288_kidney 3.97
SRP018288_liver 2.65
SRP018288_lung 3.83
SRP018856_adipose 0.19

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIV
LNISFPATGCQKLIEVD.ERKLRTFYEK.MATEV.ADALGEEWKG.VVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIV
Retrocopy
LNISFPATGCQKLIEVDNERKLRTFYEKYMATEVSADALGEEWKGNVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIV


Parental protein
DANLSVLNLVI-VKKGEKDIPGLTDTTVPRRLGPKRASRIRKL-FNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTK
DANL.VLNLVI....GEKDIPGLTDTTVPR.LGPKRASRIRK..F.LSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRR.IALKKQRTK
Retrocopy
DANLNVLNLVI\XXXGEKDIPGLTDTTVPRCLGPKRASRIRKI/FSLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRHIALKKQRTK


Parental protein
KNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK
KNKEEAAEYAKLLAKRMKEAKEK.Q.QIAKRRRLSSLRASTSKSESSQK
Retrocopy
KNKEEAAEYAKLLAKRMKEAKEKCQDQIAKRRRLSSLRASTSKSESSQK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide