RetrogeneDB ID:
retro_trub_10
Organism:
Location:
scaffold_71:736330-736888 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.57 %
Coverage:
98.35 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
cldnh
Parental gene aliases:
No gene alias available
Parental gene description:
claudin h [Source:ZFIN;Acc:ZDB-GENE-010328-8]

Genomic region (view in browser)





>retro_trub_10
ATGCGAACTCAGCTGGTCGGCGTGGGTTTGGCCTTCCTCGGCTTCCTCGGCACCATCCTC
ATCTGCGGGCTGCCCATGTGGAAGGTGACGGCCTTTGTTGGCTCAAACATCGTCACGGCT
CAGATCTTCTGGGAGGGTCTGTGGATGAACTGTGTGTTTCAGAGCACAGGTCACTCGCAG
TGCAAGGCCTACGACTCGGTTCTGGCTTTGCCACAGGAGCTGCAGGCCTCCCGGGCGTTA
ATCTGCGTCTCCATCGCTGTCAGCGTGGTGGCCATCGGACTGACCGTGGTCGGCGCCCGC
TGCACTAACTTCTACCGCGATGAAGGATTGACCAAGTCCAACATCGGCCTGTCCGGGGGC
ATTGTCTTCATCATCGCAGGAGTCTTGTGTATTATTCCTGTCAGCTGGTCCGCTCACACT
ATCATCACAGGCTTCTACAACCCTCTACCCACATCAGAGAGGAGGGGGGAACTGGGGGCC
TCCATTTATGTGGGCTGGGCATCTGGAGCTCTTCTTGTCATTGGCGGAGCGGTTTTATGC
AGCACCTACAGATGCTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QILGIGLAVLGWLGNILICMLPLWKVSAFIGANIVTAQVFWQGLWMNCVFQSTGQMQCKVYDSMLALPQDLQAARALTIVSIIVGLVALLISMVGAKCTN
Q..G.GLA.LG.LG.ILIC.LP.WKV.AF.G.NIVTAQ.FW.GLWMNCVFQSTG..QCK.YDS.LALPQ.LQA.RAL..VSI.V..VA.....VGA.CTN
Retrocopy
QLVGVGLAFLGFLGTILICGLPMWKVTAFVGSNIVTAQIFWEGLWMNCVFQSTGHSQCKAYDSVLALPQELQASRALICVSIAVSVVAIGLTVVGARCTN


Parental protein
CIEDEGGAKAKVMIIAGIFFILGGVLVLIPVSWTAHVVIRDFYNPILNNSQRRELGAALYIGWAAAALLLIGGAMLCSS
...DEG..K.......GI.FI..GVL..IPVSW.AH..I..FYNP......R.ELGA..Y.GWA..ALL.IGGA.LCS.
Retrocopy
FYRDEGLTKSNIGLSGGIVFIIAGVLCIIPVSWSAHTIITGFYNPLPTSERRGELGASIYVGWASGALLVIGGAVLCST


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide